ID DQ986557; SV 1; linear; genomic DNA; STD; INV; 591 BP. XX AC DQ986557; XX DT 01-JUN-2008 (Rel. 96, Created) DT 01-JUN-2008 (Rel. 96, Last updated, Version 1) XX DE Bulla quoyii voucher BMNH 20030344 cytochrome oxidase subunit I (COI) gene, DE partial cds; mitochondrial. XX KW . XX OS Bulla quoyii OC Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Mollusca; Gastropoda; OC Heterobranchia; Euthyneura; Euopisthobranchia; Cephalaspidea; Bulloidea; OC Bullidae; Bulla. OG Mitochondrion XX RN [1] RP 1-591 RA Malaquias M.A.E., Reid D.G.; RT "Systematic revision of the living species of Bullidae (Mollusca: RT Gastropoda: Cephalaspidea), with a molecular phylogenetic analysis"; RL Zool. J. Linn. Soc. 153(3):453-543(2008). XX RN [2] RP 1-591 RA Malaquias M.A.E., Reid D.G.; RT "Speciation and historical biogeography of bubble-shells (Mollusca, RT Gastropoda)"; RL Unpublished. XX RN [3] RP 1-591 RA Malaquias M.A.E., Reid D.G.; RT ; RL Submitted (06-SEP-2006) to the INSDC. RL Zoology, Natural History Museum, Cromwell Road, London SW7 5BD, UK XX DR MD5; dbb888bc9144ce437aef3a5295be6f6a. XX FH Key Location/Qualifiers FH FT source 1..591 FT /organism="Bulla quoyii" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /specimen_voucher="BMNH 20030344" FT /db_xref="taxon:415533" FT gene complement(<1..>591) FT /gene="COI" FT CDS complement(<1..>591) FT /codon_start=3 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit I" FT /db_xref="GOA:B3EZ11" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:B3EZ11" FT /protein_id="ABM65078.1" FT /translation="GTGLSLLIRFELGTASAFLGDDHFYNVIVTAHAFVMIFFMVMPLM FT IGGFGNWMVPLLIGAPDMSFPRMNNMSFWLLPPSFILLLVSSMIEGGAGTGWTVYPPLS FT GPIAHGSTSVDLVIFSLHLAGMSSILGAINFITTIINMRSPGITFERLSLFVWSVFVTA FT FLLLLSLPVLAGAITMLLTDRNFNTSFFDPAGG" XX SQ Sequence 591 BP; 222 A; 118 C; 122 G; 129 T; 0 other; cccctccggc agggtcaaag aaacttgtat tgaaatttcg atccgttaat aacatagtaa 60 tagcaccggc taaaacaggt agagaaagta acagaaggaa agcagttaca aatactgatc 120 aaacaaatag acttaatcgc tcgaaagtga ttccagggga ccgtatatta ataatagtag 180 tgataaaatt aatggcacca agaatagaag acattcccgc cagatgaaga gaaaaaatca 240 ccagatctac tgacgtagat ccgtgggcaa taggaccaga taagggaggg taaaccgttc 300 atccagttcc tgcccctcct tcaatcatac ttgagacaag taaaagaata aaagaaggag 360 gaagaagtca aaaacttatg ttattcatac gagggaacct tatatcgggg gcaccgatta 420 gtaaaggtac tattcagttt ccgaacccac cgattattaa aggtatcact atgaagaaaa 480 ttattacgaa agcgtgggcg gtcacaataa cattgtaaaa atggtcatct cccaagaaag 540 ccgaggcagt ccctagctcg aaccgaatta atagactcaa cccagttcct a 591 //