ID DQ092234; SV 1; linear; genomic DNA; STD; VRT; 398 BP. XX AC DQ092234; XX DT 22-DEC-2005 (Rel. 86, Created) DT 22-DEC-2005 (Rel. 86, Last updated, Version 1) XX DE Calotriton arnoldi isolate E1401.9 cytochrome b (cytb) gene, partial cds; DE mitochondrial. XX KW . XX OS Calotriton arnoldi (Montseny brook newt) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; OC Batrachia; Caudata; Salamandroidea; Salamandridae; Pleurodelinae; OC Calotriton. OG Mitochondrion XX RN [1] RP 1-398 RA Carranza S., Amat F.; RT "Taxonomy, biogeography and evolution of Euproctus (Amphibia: RT Salamandridae), with the resurrection of the genus Calotriton and the RT description of a new endemic species from the Iberian Peninsula"; RL Zool. J. Linn. Soc. 145(4):555-582(2005). XX RN [2] RP 1-398 RA Carranza S., Amat F.; RT ; RL Submitted (10-JUN-2005) to the INSDC. RL Departament de Biologia Animal, Universitat de Barcelona, Av. Diagonal 645, RL Barcelona, Barcelona E-08028, Spain XX DR MD5; a0c0db43b814c9104f932920ad387ee4. XX FH Key Location/Qualifiers FH FT source 1..398 FT /organism="Calotriton arnoldi" FT /organelle="mitochondrion" FT /isolate="E1401.9" FT /mol_type="genomic DNA" FT /db_xref="taxon:342570" FT gene <1..>398 FT /gene="cytb" FT CDS <1..>398 FT /codon_start=3 FT /transl_table=2 FT /gene="cytb" FT /product="cytochrome b" FT /db_xref="GOA:Q2QEV3" FT /db_xref="InterPro:IPR005797" FT /db_xref="InterPro:IPR016174" FT /db_xref="InterPro:IPR027387" FT /db_xref="UniProtKB/TrEMBL:Q2QEV3" FT /protein_id="AAZ94108.1" FT /translation="IMRKTHPLLKIINSSFIDLPAPSNISYWWNFGSLLGVCLITQILT FT GLFLAMHYTADTQSAFSSVAHICRDVNYGWLVRSTHANGTSLFFICIYLHIGRGLYYGS FT YLFKETWNIGVILLFLVMATAFVGYVLP" XX SQ Sequence 398 BP; 116 A; 105 C; 59 G; 118 T; 0 other; acattatacg aaaaactcac ccactactaa aaatcattaa cagctcattt attgacctcc 60 cagcaccgtc aaacatctca tactgatgaa acttcggctc tcttcttgga gtttgtctaa 120 ttacacaaat cctcacaggt cttttcttgg caatacacta cacagcagac acacaatcag 180 cattttcatc tgttgcccat atttgccgag atgttaacta tggctgacta gtacgaagca 240 cccacgccaa cggaacctca ctatttttca tttgtattta cctgcacatt ggacgaggcc 300 tatattacgg atcataccta tttaaagaaa cctgaaacat cggcgtgatc ttactattct 360 tagtcatggc aactgccttt gtcggatatg tcctgcca 398 //