ID AY688653; SV 1; linear; genomic DNA; STD; VRT; 168 BP. XX AC AY688653; XX DT 30-NOV-2005 (Rel. 86, Created) DT 30-SEP-2014 (Rel. 122, Last updated, Version 3) XX DE Notarius insculptus voucher STRI-17958 ATP synthase subunit 8 (ATP8) gene, DE complete cds; mitochondrial. XX KW . XX OS Notarius insculptus OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes; OC Ariidae; Notarius. OG Mitochondrion XX RN [1] RP 1-168 RA Betancur R., Acero P.; RT "Description of Notarius biffi n. sp. and redescription of N. insculptus RT (Jordan and Gilbert) (Siluriformes: Ariidae) from the eastern Pacific, with RT evidence of monophyly and limits of Notarius"; RL Zootaxa 703:1-20(2004). XX RN [2] RP 1-168 RA Betancur R.; RT ; RL Submitted (18-JUL-2004) to the INSDC. RL Molecular Lab at Naos, Smithsonian Tropical Research Institute, Apartado RL 2072, Balboa, Panama XX DR MD5; ac95cf1b7a5964b91d764392dd859ae7. XX FH Key Location/Qualifiers FH FT source 1..168 FT /organism="Notarius insculptus" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /specimen_voucher="STRI-17958" FT /db_xref="taxon:287707" FT gene 1..168 FT /gene="ATP8" FT CDS 1..168 FT /codon_start=1 FT /transl_table=2 FT /gene="ATP8" FT /product="ATP synthase subunit 8" FT /note="ATPase 8" FT /db_xref="GOA:Q2VW66" FT /db_xref="InterPro:IPR001421" FT /db_xref="UniProtKB/TrEMBL:Q2VW66" FT /protein_id="AAT91108.1" FT /translation="MPQLNPAPWLAILVFSWLIFLTVIPPKVLSHTFTNDLTTLDTKNL FT KSDSWNWLWY" XX SQ Sequence 168 BP; 59 A; 45 C; 15 G; 49 T; 0 other; atgccacaat taaatcccgc cccatgactt gccattcttg tattctcatg actaattttt 60 ttaacagtaa tccctcccaa agttttaagc cacactttca caaatgacct cacaacatta 120 gatactaaaa acctaaaatc agactcctga aactgactat gatactaa 168 //