ID AY278053; SV 1; linear; genomic DNA; STD; INV; 383 BP. XX AC AY278053; XX DT 01-FEB-2004 (Rel. 78, Created) DT 14-JAN-2006 (Rel. 86, Last updated, Version 2) XX DE Glypthelmins facioi cytochrome c oxidase subunit I (COI) gene, partial cds; DE mitochondrial gene for mitochondrial product. XX KW . XX OS Glypthelmins facioi OC Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Platyhelminthes; Trematoda; OC Digenea; Plagiorchiida; Xiphidiata; Plagiorchioidea; Plagiorchiidae; OC Glypthelmins. OG Mitochondrion XX RN [1] RP 1-383 RX DOI; 10.1023/B:SYPA.0000048099.73779.f4. RX PUBMED; 15542949. RA Razo-Mendivil U.J., Leon-Regagnon V., Perez-Ponce de Leon G.; RT "Description of two new species of Glypthelmins Stafford, 1905 (Digenea: RT Macroderoididae) in Rana spp. from Mexico, based on morphology and mtDNA RT and rDNA sequences"; RL Syst. Parasitol. 59(3):199-210(2004). XX RN [2] RP 1-383 RA Razo-Mendivil U.J.; RT ; RL Submitted (15-APR-2003) to the INSDC. RL Zoology, Instituto de Biologia, Universidad Nacional Autonoma de Mexico, RL Apartado Postal 70-153 Del. Coyoacan, Mexico, Distrito Federal 04510, RL Mexico XX DR MD5; 8590fbd877c3101a5f69b50ee23dc8de. XX FH Key Location/Qualifiers FH FT source 1..383 FT /organism="Glypthelmins facioi" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /country="Costa Rica" FT /isolation_source="Rana vaillanti" FT /db_xref="taxon:241479" FT gene <1..>383 FT /gene="COI" FT CDS <1..>383 FT /codon_start=1 FT /transl_table=9 FT /gene="COI" FT /product="cytochrome c oxidase subunit I" FT /db_xref="GOA:Q6WNR8" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:Q6WNR8" FT /protein_id="AAQ19612.1" FT /translation="VLILPGFGVVSHVCVSLTNNDSLFGYFGLVFAMGAIVCLGSVVWA FT HHMFMVGLDIKTAVFFSSVTMVIGIPTGIKVFSWLYMLGGCYMRLWDPVIWWIIGFIFL FT FTVGGVTGIVLSASILDMLLHDT" XX SQ Sequence 383 BP; 62 A; 47 C; 109 G; 165 T; 0 other; gtgttaatat tgccgggttt tggggttgtt agccatgttt gtgttagcct aactaataaa 60 gattctttgt ttggttattt tggtcttgtt tttgctatgg gggcgatagt ttgtttagga 120 agtgtggtgt gggcacacca catgtttatg gttgggctgg atattaagac tgctgttttt 180 tttagctctg ttaccatggt tattggtatc cccacgggga ttaaggtgtt ttcttggctg 240 tatatgcttg gggggtgcta tatgcgttta tgagatccgg tgatttggtg gattattggt 300 tttatctttt tgtttactgt tgggggggtt actggaattg ttttgtctgc ttctatcctt 360 gatatgttgt tacacgacac ttg 383 //