ID   AY095227; SV 1; linear; mRNA; STD; VRL; 288 BP.
XX
AC   AY095227;
XX
DT   02-JUL-2002 (Rel. 72, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Influenza A virus (A/Brant Goose/1/1917(H1N?)) hemagglutinin (HA) mRNA,
DE   partial cds.
XX
KW   .
XX
OS   Influenza A virus (A/Brant Goose/1/1917(H1N?))
OC   Viruses; Riboviria; Negarnaviricota; Polyploviricotina; Insthoviricetes;
OC   Articulavirales; Orthomyxoviridae; Alphainfluenzavirus.
XX
RN   [1]
RP   1-288
RX   DOI; 10.1128/JVI.76.15.7860-7862.2002.
RX   PUBMED; 12097598.
RA   Fanning T.G., Slemons R.D., Reid A.H., Janczewski T.A., Dean J.,
RA   Taubenberger J.K.;
RT   "1917 avian influenza virus sequences suggest that the 1918 pandemic virus
RT   did not acquire its hemagglutinin directly from birds";
RL   J. Virol. 76(15):7860-7862(2002).
XX
RN   [2]
RP   1-288
RA   Fanning T.G., Slemons R.D., Reid A.H., Janczewski T.A., Dean J.,
RA   Taubenberger J.K.;
RT   "Relationship of Pre-1918 Avian Influenza HA and NP Sequences to Subsequent
RT   Avian Influenza Strains";
RL   Avian Dis. 0:0(2002).
XX
RN   [3]
RP   1-288
RA   Fanning T.G., Slemons R.D., Reid A.H., Janczewski T.A., Dean J.,
RA   Taubenberger J.K.;
RT   ;
RL   Submitted (10-APR-2002) to the INSDC.
RL   Cellular Pathology and Genetics, Armed Forces Institute of Pathology, 1413
RL   Research Blvd., Bldg. 101, Rm. 1057D, Rockville, MD 20850-3125, USA
XX
DR   MD5; d3e58ab6ebf1d87e42e0798ae7f19aea.
DR   EuropePMC; PMC136362; 12097598.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..288
FT                   /organism="Influenza A virus (A/Brant Goose/1/1917(H1N?))"
FT                   /strain="A/Brant goose/1/1917 (H1N?)"
FT                   /mol_type="mRNA"
FT                   /note="obtained from preserved Brant goose (Branta
FT                   bernicula) specimen from the Smithsonian Institution's
FT                   Museum of Natural History; specimen was originally
FT                   collected by G.D. Hanna from St. Paul Island, Pribilof
FT                   Islands, Alaska, on Sept. 9, 1917"
FT                   /db_xref="taxon:194387"
FT   CDS             <1..>288
FT                   /codon_start=1
FT                   /gene="HA"
FT                   /product="hemagglutinin"
FT                   /db_xref="GOA:Q8JMV6"
FT                   /db_xref="InterPro:IPR000386"
FT                   /db_xref="InterPro:IPR001364"
FT                   /db_xref="UniProtKB/TrEMBL:Q8JMV6"
FT                   /protein_id="AAM22278.1"
FT                   /translation="DGITNKVNSVIEKMNTQFTAVGKEFNNLERKIENLNKKVDDGFLD
FT                   VWTYNAELLVLLENERTLDFHDSNVRNLYEKVRSQLRNNAKELGNGCFEFY"
XX
SQ   Sequence 288 BP; 105 A; 41 C; 66 G; 76 T; 0 other;
     gacggaataa caaataaggt gaattcagta attgaaaaga tgaacactca attcaccgct        60
     gtgggtaagg aattcaacaa tctagaaagg aaaattgaaa atctgaataa gaaagtcgat       120
     gatgggttcc tggatgtttg gacgtacaat gctgaactgc tcgttctact tgaaaatgaa       180
     agaactctgg actttcatga ttccaatgtg aggaatttat atgagaaggt cagatcacaa       240
     ctgaggaata acgccaaaga gcttggaaat ggttgctttg aattctat                    288
//