ID AM495419; SV 1; linear; genomic DNA; STD; INV; 396 BP. XX AC AM495419; XX DT 17-AUG-2007 (Rel. 92, Created) DT 17-AUG-2007 (Rel. 92, Last updated, Version 1) XX DE Progamotaenia festiva mitochondrial partial COI gene for cytochrome c DE oxidase subunit I, specimen voucher South Australian Museum 28948 XX KW COI gene; cyotchrome oxidase c subunit I. XX OS Progamotaenia festiva OC Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Platyhelminthes; Cestoda; OC Eucestoda; Cyclophyllidea; Anoplocephalidae; Progamotaenia. OG Mitochondrion XX RN [1] RP 1-396 RA Hu M.; RT ; RL Submitted (20-FEB-2007) to the INSDC. RL Hu M., Department of Veterinary Science, The University of Melbourne, 250 RL Princes Highway, Werribee, Victoria, 3030, AUSTRALIA. XX RN [2] RX DOI; 10.1017/S0031182007002752. RX PUBMED; 17462123. RA Beveridge I., Shamsi S., Hu M., Chilton N.B., Gasser R.B.; RT "Genetic variation in the mitochondrial cytochrome c oxidase subunit 1 RT within Progamotaenia festiva (Cestoda: Anoplocephalidae) from macropodid RT marsupials"; RL Parasitology 134(Pt 10):1465-1476(2007). XX DR MD5; 10ba8244dfd242bd7e6684aa691a3ada. XX FH Key Location/Qualifiers FH FT source 1..396 FT /organism="Progamotaenia festiva" FT /organelle="mitochondrion" FT /host="Macropus irma" FT /isolate="S1" FT /mol_type="genomic DNA" FT /country="Australia:Western Australia, Collie" FT /lat_lon="32.41 S 116.15 E" FT /specimen_voucher="South Australian Museum 28948" FT /collection_date="Dec-2001" FT /identified_by="Ian Beveridge" FT /db_xref="taxon:428656" FT CDS <1..>396 FT /codon_start=1 FT /transl_table=9 FT /gene="COI" FT /product="cytochrome oxidase c subunit I" FT /db_xref="GOA:A7M8N0" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A7M8N0" FT /protein_id="CAM47038.1" FT /translation="VLILPGFGVIGHICLSLSMASDVFGFYGLLFAMFSIVCLGSSVWG FT HHMFTVGLDVKTAVFFSSVTMIIGVPTGIKVFTWLYMLLSSNVNKSDPILWWIASFIVL FT FTFGGVTGIVLSACVLDNILHDTWFVVA" XX SQ Sequence 396 BP; 83 A; 37 C; 95 G; 181 T; 0 other; gtattaattt taccagggtt tggtgtaatt ggtcatattt gtttgaggtt aagaatggct 60 tcagatgttt ttggttttta tggtttgctc tttgctatgt tttctattgt gtgtttggga 120 agtagtgttt ggggacatca tatgtttacg gtaggattag atgttaagac agcggttttt 180 tttagttcag ttactatgat tattggcgtg cctactggta taaaggtgtt tacttgatta 240 tatatgttat taagctctaa tgttaacaag agagatccta ttttgtggtg gattgcttct 300 tttattgttc tttttacatt tgggggtgtt actggaattg ttttatctgc ttgtgtgcta 360 gataatattt tacatgatac ttggtttgta gtagct 396 //