ID AJ843895; SV 1; linear; genomic DNA; STD; INV; 654 BP. XX AC AJ843895; XX DT 30-SEP-2005 (Rel. 85, Created) DT 12-OCT-2005 (Rel. 85, Last updated, Version 2) XX DE Cinachyrella apion mitochondrial partial coi gene for cytochrome oxidase DE subunit I, from Flatts Inlet XX KW coi gene; cytochrome oxidase subunit I. XX OS Cinachyrella apion OC Eukaryota; Metazoa; Porifera; Demospongiae; Heteroscleromorpha; OC Tetractinellida; Spirophorina; Tetillidae; Cinachyrella. OG Mitochondrion XX RN [1] RP 1-654 RA Hess W.R.; RT ; RL Submitted (30-SEP-2004) to the INSDC. RL Hess W.R., Experimental Bioinformatics, University of Freiburg, RL Schaenzlestr. 1, Freiburg, 79104, GERMANY. XX RN [2] RA Hess W.R., Nie Q., Ruetzler K., Bohne A.V., Sterrer W., Meixner M.; RT "The evolving genetic code in mitochondria of sponges (Porifera): UGA as RT coding for Tryptophan and implications for the barcoding of species"; RL Unpublished. XX DR MD5; 8a9f0862ffea1f36c58c3c4f866bce9f. XX FH Key Location/Qualifiers FH FT source 1..654 FT /organism="Cinachyrella apion" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /country="Bermuda:Flatts Inlet" FT /db_xref="taxon:263142" FT CDS <1..>654 FT /codon_start=1 FT /transl_table=4 FT /gene="coi" FT /product="cytochrome oxidase subunit I" FT /db_xref="GOA:Q3LEF0" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:Q3LEF0" FT /protein_id="CAH59214.1" FT /translation="LYLLFGLFSGMIGSGFSMLIRLELSNPGSMLGDDQLYNVMVTAHG FT LIMVFFLVMPVMIGGFGNWFVPLYIGAPDMAFPRLNNISFWVLPPSIILLLGSAFIEQG FT VGTGWTLYPPLSSIQAHSGGSVDAAIFSIHLAGLSSILGSMNFITTIFNMRAPGITMDR FT LPLFVWSILVTTYLLLLTLPVLAGAITMLLTDRNFNTTFFDPAGGGDPILFQHLF" XX SQ Sequence 654 BP; 162 A; 108 C; 131 G; 253 T; 0 other; ttatacttat tatttggtct tttttcgggt atgataggta gtgggtttag tatgcttatt 60 agattagaac tatccaaccc cgggtcaatg ttgggggatg accaattata taatgttatg 120 gtcacggccc acggtcttat aatggtcttt ttcttagtta tgccagttat gataggtggg 180 tttggtaatt gatttgttcc actttatatc ggtgcgccgg atatggcttt cccaagatta 240 aacaatatta gtttttgagt tttaccccct tcaataatat tactgttagg ttctgctttt 300 attgaacaag gggttgggac aggatgaacc ctttatccac cattatcaag tatacaagct 360 cattcagggg gctcagttga tgcggcaatt tttagtattc atttggccgg tctttcttca 420 attttagggt cgatgaactt tataactact atctttaata tgcgagcacc agggattacc 480 atggatagat tgcctttatt tgtttgatct attttagtaa caacttactt gttattatta 540 actttgcctg tattggcggg tgcaattact atgcttttaa cagatagaaa tttcaataca 600 acattcttcg atcccgctgg tggtggtgat ccaatattat ttcaacattt attt 654 //