ID AJ275053; SV 1; linear; genomic DNA; STD; INV; 331 BP. XX AC AJ275053; XX DT 02-DEC-1999 (Rel. 61, Created) DT 12-AUG-2005 (Rel. 84, Last updated, Version 3) XX DE Zygobothrium megacephalum mitochondrial partial co1 gene for cytochrome DE oxidase 1 XX KW co1 gene; cytochrome oxidase 1. XX OS Zygobothrium megacephalum OC Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Platyhelminthes; Cestoda; OC Eucestoda; Proteocephalidea; Monticelliidae; Zygobothriinae; Zygobothrium. OG Mitochondrion XX RN [1] RP 1-331 RA Zehnder M.P.; RT ; RL Submitted (21-NOV-1999) to the INSDC. RL Zehnder M.P., Department of Parasitology, University of Neuchatel, RL Institute of Zoology, E.-Argand, 11, 2007 Neuchatel, SWITZERLAND. XX RN [2] RA Zehnder M.P.; RT "Molecular phylogeny of the Proteocephalidea (Eucestoda)"; RL Unpublished. XX DR MD5; 39ceceaa2b78db75bcb339ddf8277dc7. XX FH Key Location/Qualifiers FH FT source 1..331 FT /organism="Zygobothrium megacephalum" FT /organelle="mitochondrion" FT /host="Phractocephalus hemioliopterus" FT /mol_type="genomic DNA" FT /country="Brazil:Itacoatiara, Amazonas Province" FT /specimen_voucher="21846 INVE" FT /db_xref="taxon:100422" FT CDS <1..>331 FT /codon_start=1 FT /transl_table=14 FT /gene="co1" FT /product="cytochrome oxidase 1" FT /function="Essential in oxidative phosphorylation" FT /db_xref="GOA:Q9T9L9" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:Q9T9L9" FT /protein_id="CAB62286.1" FT /translation="GMVSHACLNMGCAPDVFGFYGLVFASFSIVCLGSVVWAHHMFTVG FT LDVKTAVFFSSVTMVIGVPTGIKVFTWLYMLLNSNVNKSDPVFLWVVSFIVLFTFGGVT FT GIVLSA" XX SQ Sequence 331 BP; 70 A; 39 C; 81 G; 141 T; 0 other; ggtatggtta gacatgcatg tttaaatatg gggtgtgctc cagatgtatt tggcttttat 60 ggtctggttt ttgctagatt ttctattgtt tgccttggga gtgtagtttg agcacatcac 120 atgtttactg ttggtttaga tgtaaagacg gcggttttct ttagttctgt tactatggta 180 attggtgtgc ccacaggtat taaggttttt acttggttat acatgttgct aaatagaaat 240 gttaataaga gagatcctgt atttttatgg gttgtttcct ttattgtact attcacattt 300 ggtggtgtga caggtattgt cttatctgca t 331 //