ID AF444850; SV 1; linear; genomic DNA; STD; INV; 379 BP. XX AC AF444850; XX DT 27-JUN-2002 (Rel. 72, Created) DT 31-AUG-2011 (Rel. 109, Last updated, Version 4) XX DE Austrophilopterus subsimilis cytochrome oxidase subunit I gene, partial DE cds; mitochondrial. XX KW . XX OS Austrophilopterus subsimilis OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Paraneoptera; Psocodea; Phthiraptera; Ischnocera; Philopteridae; OC Austrophilopterus. OG Mitochondrion XX RN [1] RP 1-379 RX DOI; 10.1016/S1055-7903(02)00014-3. RX PUBMED; 12069547. RA Johnson K.P., Weckstein J.D., Witt C.C., Faucett R.C., Moyle R.G.; RT "The perils of using host relationships in parasite taxonomy: phylogeny of RT the Degeeriella complex"; RL Mol. Phylogenet. Evol. 23(2):150-157(2002). XX RN [2] RP 1-379 RA Johnson K.P., Weckstein J.D., Witt C.C., Faucett R.C., Moyle R.G.; RT ; RL Submitted (07-NOV-2001) to the INSDC. RL Illinois Natural History Survey, 607 East Peabody Drive, Champaign, IL RL 61820, USA XX DR MD5; d9bab08c023bfa77e709760acd7a692c. XX FH Key Location/Qualifiers FH FT source 1..379 FT /organism="Austrophilopterus subsimilis" FT /organelle="mitochondrion" FT /host="Ramphastos sulfuratus" FT /mol_type="genomic DNA" FT /country="Mexico" FT /specimen_voucher="Ausub.1.27.1999.12 (Price Institute for FT Pthirapteran Research, University of Utah, Salt Lake City)" FT /db_xref="taxon:138826" FT CDS <1..>379 FT /codon_start=2 FT /transl_table=5 FT /product="cytochrome oxidase subunit I" FT /db_xref="GOA:Q8M310" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:Q8M310" FT /protein_id="AAM66259.1" FT /translation="EVYILILPGFGLISHMVVEQSGKMEAFGSLGMIYAMVSIGLLGFI FT VWAHHMFTVGMDVDSRAYFTSATMVIAVPTGIKVFSWLATMFGSGKFSGVSSMWSIGFI FT FLFTVGGMTGVVLANSALDVSL" XX SQ Sequence 379 BP; 83 A; 57 C; 107 G; 132 T; 0 other; cgaggtgtac attcttattc tccctgggtt tggtctgatc tcacacatag tagtggagca 60 aagaggtaag atagaagctt ttggtagact gggaatgatc tatgctatgg tgtctattgg 120 attgcttggg tttatcgttt gggcccacca catatttaca gttgggatag atgttgatag 180 gcgggcttat tttacaaggg ccactatggt tattgctgta cctactggca tcaaggtgtt 240 tagatggctg gcaactatat ttgggtctgg caagtttaga ggcgtaagtt ctatgtggtc 300 tattggattc atcttcttgt ttacagtagg aggaatgact ggcgtggtgt tagcaaattc 360 tgcgttagat gtgtctttg 379 //