ID AF444849; SV 1; linear; genomic DNA; STD; INV; 379 BP. XX AC AF444849; XX DT 27-JUN-2002 (Rel. 72, Created) DT 31-AUG-2011 (Rel. 109, Last updated, Version 4) XX DE Austrophilopterus torquatus cytochrome oxidase subunit I gene, partial cds; DE mitochondrial. XX KW . XX OS Austrophilopterus torquatus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Paraneoptera; Psocodea; Phthiraptera; Ischnocera; Philopteridae; OC Austrophilopterus. OG Mitochondrion XX RN [1] RP 1-379 RX DOI; 10.1016/S1055-7903(02)00014-3. RX PUBMED; 12069547. RA Johnson K.P., Weckstein J.D., Witt C.C., Faucett R.C., Moyle R.G.; RT "The perils of using host relationships in parasite taxonomy: phylogeny of RT the Degeeriella complex"; RL Mol. Phylogenet. Evol. 23(2):150-157(2002). XX RN [2] RP 1-379 RA Johnson K.P., Weckstein J.D., Witt C.C., Faucett R.C., Moyle R.G.; RT ; RL Submitted (07-NOV-2001) to the INSDC. RL Illinois Natural History Survey, 607 East Peabody Drive, Champaign, IL RL 61820, USA XX DR MD5; 75e7e95ac5338b0af8bf7453f30d57cf. XX FH Key Location/Qualifiers FH FT source 1..379 FT /organism="Austrophilopterus torquatus" FT /organelle="mitochondrion" FT /host="Pteroglossus torquatus" FT /mol_type="genomic DNA" FT /country="Mexico" FT /specimen_voucher="Ausp.Pttor.1.27.1999.1 (Price Institute FT for Pthirapteran Research, University of Utah, Salt Lake FT City)" FT /db_xref="taxon:194579" FT CDS <1..>379 FT /codon_start=2 FT /transl_table=5 FT /product="cytochrome oxidase subunit I" FT /db_xref="GOA:Q8M311" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:Q8M311" FT /protein_id="AAM66258.1" FT /translation="EVYILILPGFGLISHMVVEQSGKMEAFGSLGMIYAMVSIGLLGFI FT VWAHHMFTVGMDVDSRAYFTSATMVIXVPXGIKVFSWLATVFGSGKLSGVSSLWSVGFI FT FLFTVGGMTGVVLANSALDVSL" XX SQ Sequence 379 BP; 84 A; 61 C; 107 G; 123 T; 4 other; tgaagtttac attctcattc ttcctggatt tggcctcatc tcacacatgg tggtagagca 60 aaggggcaag atagaagcct ttggtagatt gggaataatc tatgctatgg tatctattgg 120 gctgcttggg tttatcgttt gggcgcacca tatgtttaca gttggtatgg acgtagacag 180 acgtgcttac tttacnaggg ccaccatagt aatcgntgtn cctantggta ttaaggtgtt 240 caggtggtta gcaactgtgt tcgggtctgg aaaacttaga ggagtaaggt cattgtgatc 300 tgtcgggttc atttttctgt ttacagtggg aggaataacg ggtgtagtat tggcaaactc 360 tgcgttggat gtgtccctg 379 //