ID AF414806; SV 1; linear; genomic DNA; STD; INV; 379 BP. XX AC AF414806; XX DT 22-FEB-2002 (Rel. 70, Created) DT 29-SEP-2010 (Rel. 106, Last updated, Version 2) XX DE Physconelloides eurysema voucher Pheur.1.25.2000.2 cytochrome oxidase DE subunit I (COI) gene, partial cds; mitochondrial. XX KW . XX OS Physconelloides eurysema OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Paraneoptera; Psocodea; Phthiraptera; Ischnocera; Philopteridae; OC Physconelloides. OG Mitochondrion XX RN [1] RP 1-379 RX DOI; 10.1046/j.0962-1083.2001.01412.x. RX PUBMED; 11903902. RA Johnson K.P., Williams B.L., Drown D.M., Adams R.J., Clayton D.H.; RT "The population genetics of host specificity: genetic differentiation in RT dove lice (Insecta: Phthiraptera)"; RL Mol. Ecol. 11(1):25-38(2002). XX RN [2] RP 1-379 RA Johnson K.P., Williams B.L., Drown D.M., Adams R.J., Clayton D.H.; RT ; RL Submitted (29-AUG-2001) to the INSDC. RL Center for Biodiversity, Illinois Natural History Survey, 607 East Peabody RL Drive, Champaign, IL 61820, USA XX DR MD5; cea483e3b5330209b32acda209223a7f. XX FH Key Location/Qualifiers FH FT source 1..379 FT /organism="Physconelloides eurysema" FT /organelle="mitochondrion" FT /host="Claravis pretiosa GES382" FT /mol_type="genomic DNA" FT /specimen_voucher="Pheur.1.25.2000.2" FT /db_xref="taxon:135605" FT gene <1..>379 FT /gene="COI" FT CDS <1..>379 FT /codon_start=2 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit I" FT /db_xref="GOA:Q8SEE2" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:Q8SEE2" FT /protein_id="AAL78866.1" FT /translation="EVYILILPGFGLISHMLSDNSGKMEVFGSLGMIYAMVAIGVLGFI FT VWAHHMFTVGLDVDSRAYFTSATMVIAVPTGVKVFSWMATLFGSRVMWAPSELWGIGFI FT FLFTVGGLTGVVLANSSLDIVL" XX SQ Sequence 379 BP; 87 A; 51 C; 96 G; 145 T; 0 other; agaagtttat attttaattc tccctggatt tggattaatt tcccatatac ttagagacaa 60 taggggtaaa atagaagttt ttgggtctct gggaataatt tatgcgatag tggcaattgg 120 ggtgttaggg tttattgttt gggcccatca tatgtttaca gttggattgg atgttgatag 180 gcgggcttat tttacttccg caactatagt aattgctgtt cccacaggag taaaggtttt 240 tagatggatg gctactttat ttgggagacg agtgatgtgg gctccttctg aattatgggg 300 aattgggttt atctttcttt tcactgtagg gggcttaact ggtgtagttt tagctaactc 360 ctccttagat attgttctc 379 //