ID AF414784; SV 1; linear; genomic DNA; STD; INV; 379 BP. XX AC AF414784; XX DT 22-FEB-2002 (Rel. 70, Created) DT 29-SEP-2010 (Rel. 106, Last updated, Version 2) XX DE Physconelloides ceratoceps voucher Phcer.1.25.1999.8 cytochrome oxidase DE subunit I (COI) gene, partial cds; mitochondrial. XX KW . XX OS Physconelloides ceratoceps OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Paraneoptera; Psocodea; Phthiraptera; Ischnocera; Philopteridae; OC Physconelloides. OG Mitochondrion XX RN [1] RP 1-379 RX DOI; 10.1046/j.0962-1083.2001.01412.x. RX PUBMED; 11903902. RA Johnson K.P., Williams B.L., Drown D.M., Adams R.J., Clayton D.H.; RT "The population genetics of host specificity: genetic differentiation in RT dove lice (Insecta: Phthiraptera)"; RL Mol. Ecol. 11(1):25-38(2002). XX RN [2] RP 1-379 RA Johnson K.P., Williams B.L., Drown D.M., Adams R.J., Clayton D.H.; RT ; RL Submitted (29-AUG-2001) to the INSDC. RL Center for Biodiversity, Illinois Natural History Survey, 607 East Peabody RL Drive, Champaign, IL 61820, USA XX DR MD5; 83a3462410f9b3f023e433e95ca4b7b2. XX FH Key Location/Qualifiers FH FT source 1..379 FT /organism="Physconelloides ceratoceps" FT /organelle="mitochondrion" FT /host="Leptotila verreauxi fulviventris GES387" FT /mol_type="genomic DNA" FT /specimen_voucher="Phcer.1.25.1999.8" FT /db_xref="taxon:135603" FT gene <1..>379 FT /gene="COI" FT CDS <1..>379 FT /codon_start=2 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit I" FT /db_xref="GOA:Q8SED0" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:Q8SED0" FT /protein_id="AAL78844.1" FT /translation="EVYILILPGFGLISHMLSDNSGKMEVFGSLGMIYAMVAIGVLGFI FT VWAHHMFTVGLDVDSRAYFTSATMVIAVPTGVKVFSWMATLFGSRVLWSPSELWGIGFI FT FLFTVGGLTGVVLANSSLDIVL" XX SQ Sequence 379 BP; 98 A; 40 C; 92 G; 149 T; 0 other; agaagtatat attttaattc ttcctggatt tggattaatt tctcacatgt taagggataa 60 taggggaaaa atagaggttt ttggatcatt aggaataatt tatgcgatag ttgcaattgg 120 ggttttagga tttattgttt gggctcatca tatgtttact gtaggattag atgtggatag 180 acgagcttat tttacttctg caactatagt aattgctgtt cctacaggag taaaggtttt 240 tagatgaatg gccactttgt ttgggaggcg agtattatga agaccttcgg aactatgagg 300 gattgggttc atttttcttt ttactgtagg gggattaact ggagtagttt tagctaattc 360 gtctcttgat attgttctt 379 //