ID AF414779; SV 1; linear; genomic DNA; STD; INV; 379 BP. XX AC AF414779; XX DT 22-FEB-2002 (Rel. 70, Created) DT 29-SEP-2010 (Rel. 106, Last updated, Version 4) XX DE Physconelloides ceratoceps voucher Phcer.1.25.1999.4 cytochrome oxidase DE subunit I (COI) gene, partial cds; mitochondrial. XX KW . XX OS Physconelloides ceratoceps OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Paraneoptera; Psocodea; Phthiraptera; Ischnocera; Philopteridae; OC Physconelloides. OG Mitochondrion XX RN [1] RP 1-379 RA Johnson K.P., Cruickshank R., Adams R.J., Smith V.S., Page R.D.M., RA Clayton D.H.; RT "Dramatically elevated rate of mitochondrial substitution in lice (Insecta: RT Phthiraptera)"; RL Mol. Phylogenet. Evol. 0:0(2002). XX RN [2] RP 1-379 RX DOI; 10.1046/j.0962-1083.2001.01412.x. RX PUBMED; 11903902. RA Johnson K.P., Williams B.L., Drown D.M., Adams R.J., Clayton D.H.; RT "The population genetics of host specificity: genetic differentiation in RT dove lice (Insecta: Phthiraptera)"; RL Mol. Ecol. 11(1):25-38(2002). XX RN [3] RP 1-379 RA Johnson K.P., Williams B.L., Drown D.M., Adams R.J., Clayton D.H.; RT ; RL Submitted (29-AUG-2001) to the INSDC. RL Center for Biodiversity, Illinois Natural History Survey, 607 East Peabody RL Drive, Champaign, IL 61820, USA XX DR MD5; ebf565e0ac32226af2ee33691260d9d9. XX FH Key Location/Qualifiers FH FT source 1..379 FT /organism="Physconelloides ceratoceps" FT /organelle="mitochondrion" FT /host="Leptotila plumbeiceps GES288" FT /mol_type="genomic DNA" FT /specimen_voucher="Phcer.1.25.1999.4" FT /db_xref="taxon:135603" FT gene <1..>379 FT /gene="COI" FT CDS <1..>379 FT /codon_start=2 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit I" FT /db_xref="GOA:Q8SEC7" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:Q8SEC7" FT /protein_id="AAL78839.1" FT /translation="EVYILILPGFGLISHMLSDNSGKMEVFGSLGMIYAMVAIGVLGFI FT VWAHHMFTVGLDVDSRAYFTSATMVIAVPTGVKVFSWMATLFGSRVLWSPSELWGIGFI FT FLFTIGGLTGVVLANSSLDIVL" XX SQ Sequence 379 BP; 95 A; 41 C; 92 G; 151 T; 0 other; agaagtgtat attttaattc ttcctggatt tggattaatt tctcacatat taagagataa 60 tagaggaaaa atagaggttt ttgggtcatt aggaatgatt tatgcaatag ttgcaattgg 120 agttttaggg tttattgttt gggctcatca tatgtttaca gtaggcttag acgttgatag 180 gcgagcttat tttacttctg caactatagt aattgctgtt cctacaggag taaaagtttt 240 tagatggatg gctactttgt ttggaagacg ggtgttatga aggccttcag agttgtgagg 300 gattggattt atttttcttt ttactattgg aggattgact ggggtggttt tagccaattc 360 ttctcttgat attgttctc 379 //