ID AF414774; SV 1; linear; genomic DNA; STD; INV; 354 BP. XX AC AF414774; XX DT 22-FEB-2002 (Rel. 70, Created) DT 29-SEP-2010 (Rel. 106, Last updated, Version 2) XX DE Physconelloides ceratoceps voucher Phcer.4.24.1999.8 cytochrome oxidase DE subunit I (COI) gene, partial cds; mitochondrial. XX KW . XX OS Physconelloides ceratoceps OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Paraneoptera; Psocodea; Phthiraptera; Ischnocera; Philopteridae; OC Physconelloides. OG Mitochondrion XX RN [1] RP 1-354 RX DOI; 10.1046/j.0962-1083.2001.01412.x. RX PUBMED; 11903902. RA Johnson K.P., Williams B.L., Drown D.M., Adams R.J., Clayton D.H.; RT "The population genetics of host specificity: genetic differentiation in RT dove lice (Insecta: Phthiraptera)"; RL Mol. Ecol. 11(1):25-38(2002). XX RN [2] RP 1-354 RA Johnson K.P., Williams B.L., Drown D.M., Adams R.J., Clayton D.H.; RT ; RL Submitted (29-AUG-2001) to the INSDC. RL Center for Biodiversity, Illinois Natural History Survey, 607 East Peabody RL Drive, Champaign, IL 61820, USA XX DR MD5; 673791acfb8f4c22e3830245b1863869. XX FH Key Location/Qualifiers FH FT source 1..354 FT /organism="Physconelloides ceratoceps" FT /organelle="mitochondrion" FT /host="Leptotila plumbeiceps CO-36" FT /mol_type="genomic DNA" FT /specimen_voucher="Phcer.4.24.1999.8" FT /db_xref="taxon:135603" FT gene <1..>354 FT /gene="COI" FT CDS <1..>354 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit I" FT /db_xref="GOA:Q8SKK2" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:Q8SKK2" FT /protein_id="AAL78834.1" FT /translation="GFGLISHMLSDNSGKMEVFGSLGMIYAMVAIGVLGFIVWAHHMFT FT VGLDVDSRAYFTSATMVIAVPTGVKVFSWMATLFGSRVLWSPSELWGIGFIFLFTIGGL FT TGVVLANSSLDIVL" XX SQ Sequence 354 BP; 88 A; 37 C; 89 G; 140 T; 0 other; ggatttggat taatttctca catattaaga gataatagag gaaaaataga ggtttttggg 60 tcattaggaa tgatttatgc aatagttgca attggagttt tagggtttat tgtttgggct 120 catcatatgt ttacagtagg tttagacgtt gataggcgag cttattttac ttctgcaact 180 atagtaattg ctgttcctac aggagtaaaa gtttttagat ggatggctac tttgtttgga 240 agacgggtgt tatgaaggcc ttcagagttg tgagggattg gatttatttt tctttttact 300 attggaggat tgactggggt ggttttagcc aattcttctc ttgatattgt tctc 354 //