ID AF414766; SV 1; linear; genomic DNA; STD; INV; 379 BP. XX AC AF414766; XX DT 22-FEB-2002 (Rel. 70, Created) DT 29-SEP-2010 (Rel. 106, Last updated, Version 2) XX DE Physconelloides cubanus voucher Phcub.1.25.1999.9 cytochrome oxidase DE subunit I (COI) gene, partial cds; mitochondrial. XX KW . XX OS Physconelloides cubanus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Paraneoptera; Psocodea; Phthiraptera; Ischnocera; Philopteridae; OC Physconelloides. OG Mitochondrion XX RN [1] RP 1-379 RX DOI; 10.1046/j.0962-1083.2001.01412.x. RX PUBMED; 11903902. RA Johnson K.P., Williams B.L., Drown D.M., Adams R.J., Clayton D.H.; RT "The population genetics of host specificity: genetic differentiation in RT dove lice (Insecta: Phthiraptera)"; RL Mol. Ecol. 11(1):25-38(2002). XX RN [2] RP 1-379 RA Johnson K.P., Williams B.L., Drown D.M., Adams R.J., Clayton D.H.; RT ; RL Submitted (29-AUG-2001) to the INSDC. RL Center for Biodiversity, Illinois Natural History Survey, 607 East Peabody RL Drive, Champaign, IL 61820, USA XX DR MD5; 186b2ee5cae48456f47fc5abfe40c9ce. XX FH Key Location/Qualifiers FH FT source 1..379 FT /organism="Physconelloides cubanus" FT /organelle="mitochondrion" FT /host="Geotrygon montana GES308" FT /mol_type="genomic DNA" FT /specimen_voucher="Phcub.1.25.1999.9" FT /db_xref="taxon:135604" FT gene <1..>379 FT /gene="COI" FT CDS <1..>379 FT /codon_start=2 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit I" FT /db_xref="GOA:Q8SEC9" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:Q8SEC9" FT /protein_id="AAL78826.1" FT /translation="EVYILILPGFGLISHMLSDNSGKMEVFGSLGMIYAMVAIGVLGFI FT VWAHHMFTVGLDVDSRAYFTSATMVIAVPTGVKVFSWMATLFGSRVLWSPSELWGIGFI FT FLFTVGGLTGVVLANSSLDIVL" XX SQ Sequence 379 BP; 98 A; 40 C; 91 G; 150 T; 0 other; ggaagtatat attttaattc ttcctggatt tggattaatc tcccatatat taagagataa 60 tagaggaaag atagaggttt ttgggtcatt aggaatgatt tatgcaatag ttgcaattgg 120 agttttagga tttattgtat gggcacatca tatgtttaca gttgggttgg atgttgatag 180 gcgagcttat tttacttctg caacaatagt aattgctgtt cctacaggag taaaggtttt 240 tagatgaatg gctactttat ttggaaggcg agttctatgg agaccttcag agttgtgggg 300 aattggattt atttttcttt ttactgttgg aggtttaact ggagttgttt tagcaaactc 360 gtctcttgat attgttctt 379 //