ID AF245355; SV 1; linear; genomic DNA; STD; INV; 611 BP. XX AC AF245355; XX DT 30-MAY-2000 (Rel. 63, Created) DT 22-SEP-2006 (Rel. 89, Last updated, Version 2) XX DE Holopedium glacialis haplotype 1-5 cytochrome oxidase I (COI) gene, partial DE cds; mitochondrial. XX KW . XX OS Holopedium glacialis OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea; Branchiopoda; OC Diplostraca; Cladocera; Ctenopoda; Holopediidae; Holopedium. OG Mitochondrion XX RN [1] RP 1-611 RA Rowe C.L., Adamowicz S.J., Hebert P.D.; RT "Cryptic diversity in the freshwater zooplankton genus Holopedium: genetic RT and morphological characterization of five species"; RL Unpublished. XX RN [2] RP 1-611 RA Rowe C.L., Hebert P.D.; RT ; RL Submitted (15-MAR-2000) to the INSDC. RL Zoology, University of Guelph, Guelph, ON N1G2W1, Canada XX DR MD5; 2388f8ec05484b7f81987175c5065417. XX FH Key Location/Qualifiers FH FT source 1..611 FT /organism="Holopedium glacialis" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /haplotype="1-5" FT /note="Holopedium glacialis n.sp. Rowe 2000" FT /db_xref="taxon:126384" FT gene <1..>611 FT /gene="COI" FT CDS <1..>611 FT /codon_start=2 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase I" FT /db_xref="GOA:Q9MK81" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:Q9MK81" FT /protein_id="AAF72516.1" FT /translation="YFMFGIWAGMVGTALSMLIRAELGQCGSLIGDDQIYNVIVTAHAF FT IMIFFMVMPILIGGFGNWLVPLMLGAPDMAFPRLNNLSFWLLPPSLTLLLLGSAVESGA FT GTGWTVYPPLSSTIAHAGASVDLSIFSLHLAGISSILGAVNFITTILNMRSLGVRLDRM FT PLFVWAVGITALLLLLSLPVLAGAITMLPTDRNLNTSFFD" XX SQ Sequence 611 BP; 140 A; 115 C; 132 G; 224 T; 0 other; ttatttcata tttggtattt gagccgggat agtaggcact gctttaagta tgctaattcg 60 ggcagaattg ggtcaatgtg gtagattaat tggagatgat cagatctata acgttattgt 120 tacagcacat gcattcatta taatcttttt catagttata ccgattttaa tcggggggtt 180 tggtaactga ctagttcccc taatattagg ggctcctgat atggccttcc cgcgattaaa 240 taatctaaga ttttgacttt tacctccctc tttaacactt ctactgcttg ggagggcagt 300 ggagagcggg gccgggactg gttgaacagt gtatcctccc ctatctagaa ctattgctca 360 cgctggggct tcagttgact taagaatctt ctcgttgcat ctagcaggaa tttcttctat 420 tttgggagca gttaatttta ttactactat tcttaatata cgaagactag gtgtacgact 480 tgaccgtatg cctctctttg tatgggctgt aggtattacg gctttgcttc ttttactgag 540 tttacccgtg ttagctgggg ctattactat gcttcctacc gatcgtaatt taaatacttc 600 tttttttgat c 611 //