ID AF092157; SV 1; linear; genomic DNA; STD; VRT; 424 BP. XX AC AF092157; XX DT 06-OCT-1998 (Rel. 57, Created) DT 03-DEC-2003 (Rel. 78, Last updated, Version 3) XX DE Aplodactylus arctidens tRNA-Glu gene, partial sequence, and cytochrome b DE gene, partial cds, mitochondrial genes for mitochondrial products. XX KW . XX OS Aplodactylus arctidens OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; OC Eupercaria; Centrarchiformes; Cirrhitioidei; Aplodactylidae; Aplodactylus. OG Mitochondrion XX RN [1] RP 1-424 RX DOI; 10.1016/S1055-7903(03)00157-X. RX PUBMED; 15022763. RA Burridge C.P., Smolenski A.J.; RT "Molecular phylogeny of the Cheilodactylidae and Latridae (Perciformes: RT Cirrhitoidea) with notes on taxonomy and biogeography"; RL Mol. Phylogenet. Evol. 30(1):118-127(2004). XX RN [2] RP 1-424 RA Burridge C.P.; RT "Molecular phylogeny of Goniistius spp. (Perciformes: Cheilodactylidae), RT with implications for taxonomy and biogeography"; RL Unpublished. XX RN [3] RP 1-424 RA Burridge C.P.; RT ; RL Submitted (16-SEP-1998) to the INSDC. RL School of Zoology, University of Tasmania, GPO Box 252-05, Hobart, Tasmania RL 7001, Australia XX DR MD5; d0ff75a65f30b98a75940ca281a9e875. XX FH Key Location/Qualifiers FH FT source 1..424 FT /organism="Aplodactylus arctidens" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /country="Australia:Maria Island, Tasmania" FT /db_xref="taxon:82892" FT tRNA <1..23 FT /product="tRNA-Glu" FT CDS 23..>424 FT /codon_start=1 FT /transl_table=2 FT /product="cytochrome b" FT /db_xref="GOA:O79820" FT /db_xref="InterPro:IPR005797" FT /db_xref="InterPro:IPR016174" FT /db_xref="InterPro:IPR027387" FT /db_xref="UniProtKB/TrEMBL:O79820" FT /protein_id="AAC62763.1" FT /translation="MASLRKTHPLLKIANDALVDLPAPSNISVWWNFGSLLGLCLIIQI FT LTGLFLAMHYTSDITTAFSSVVHICRDVNYGWLIRNIHANGASFFFICIYMHIGRGLYY FT GSYLYKETWNVGVILLLLVMMTAFVGYVLP" XX SQ Sequence 424 BP; 104 A; 118 C; 67 G; 135 T; 0 other; ttcttcaact acaggaactc taatggcaag cctacgcaaa acccacccac tcctaaaaat 60 cgcaaatgac gccctcgtcg atcttccagc cccctccaat atttcagtct ggtggaattt 120 cggttctctc cttggccttt gcttaattat ccaaatcctc acaggactat ttttggccat 180 acactacacc tctgatatta caacagcctt ctcgtccgta gttcacatct gccgagatgt 240 aaattatgga tgacttattc gtaatattca tgctaacggt gcatccttct tttttatctg 300 catttacatg catattggcc gaggccttta ttacggctca tatctctaca aagagacctg 360 aaacgtaggg gtcattcttc ttctcttagt gataataact gccttcgtag gttacgtcct 420 cccc 424 //