ID AF092155; SV 1; linear; genomic DNA; STD; VRT; 499 BP. XX AC AF092155; XX DT 06-OCT-1998 (Rel. 57, Created) DT 03-DEC-2003 (Rel. 78, Last updated, Version 3) XX DE Cirrhitus splendens cytochrome c oxidase subunit 1 gene, mitochondrial gene DE encoding mitochondrial protein, partial cds. XX KW . XX OS Notocirrhitus splendens OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; OC Eupercaria; Centrarchiformes; Cirrhitioidei; Cirrhitidae; Notocirrhitus. OG Mitochondrion XX RN [1] RP 1-499 RX DOI; 10.1016/S1055-7903(03)00157-X. RX PUBMED; 15022763. RA Burridge C.P., Smolenski A.J.; RT "Molecular phylogeny of the Cheilodactylidae and Latridae (Perciformes: RT Cirrhitoidea) with notes on taxonomy and biogeography"; RL Mol. Phylogenet. Evol. 30(1):118-127(2004). XX RN [2] RP 1-499 RA Burridge C.P.; RT "Molecular phylogeny of Goniistius spp. (Perciformes: Cheilodactylidae), RT with implications for taxonomy and biogeography"; RL Unpublished. XX RN [3] RP 1-499 RA Burridge C.P.; RT ; RL Submitted (16-SEP-1998) to the INSDC. RL School of Zoology, University of Tasmania, GPO Box 252-05, Hobart, Tasmania RL 7001, Australia XX DR MD5; 8902e0eaf1e1d82278f58b52d5a1db13. XX FH Key Location/Qualifiers FH FT source 1..499 FT /organism="Notocirrhitus splendens" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /note="Lord Howe Island" FT /db_xref="taxon:76916" FT CDS <1..>499 FT /codon_start=2 FT /transl_table=2 FT /product="cytochrome c oxidase subunit 1" FT /note="COI" FT /db_xref="GOA:O79818" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023615" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:O79818" FT /protein_id="AAC64963.1" FT /translation="ILYQHLFWFFGHPEVYILILPGFGMISHIVAYYSGKKEPFGYMGM FT VWAMMAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGVI FT KWETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIVA FT AFV" XX SQ Sequence 499 BP; 127 A; 106 C; 92 G; 174 T; 0 other; catcctttat caacacctgt tctgattctt tggtcatccg gaagtctata ttcttattct 60 cccagggttc ggtataattt cacatattgt agcctattat tctggaaaaa aagaaccatt 120 tggttatatg ggaatagttt gagctatgat agcaattgga ttactcggct ttatcgtttg 180 agcccatcat atgttcacag tcggtataga tgtagataca cgcgcttact tcacctctgc 240 cactataatt atcgcaattc ccacaggggt aaaagttttc agctgattag caacattgca 300 cggaggagta attaaatgag aaacccctct tctatgagcc cttggcttta ttttcctctt 360 tacagtaggg ggactcactg gaattgtttt agctaattct tctttagaca ttgtccttca 420 cgatacatac tacgtagtag ctcacttcca ctatgtcctg tcaataggag ctgtattcgc 480 tattgttgca gcattcgtt 499 //