ID AB930456; SV 1; linear; genomic DNA; STD; INV; 314 BP. XX AC AB930456; XX DT 11-JUL-2014 (Rel. 121, Created) DT 30-SEP-2014 (Rel. 122, Last updated, Version 2) XX DE Opaliopsis sp. TT-2014 H3 gene for histone H3, partial cds, isolate: DE YK1775. XX KW . XX OS Opaliopsis sp. TT-2014 OC Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Mollusca; Gastropoda; OC Caenogastropoda; Caenogastropoda incertae sedis; Epitonioidea; OC Nystiellidae; Opaliopsis; unclassified Opaliopsis. XX RN [1] RP 1-314 RA Takano T., Kano Y.; RT ; RL Submitted (24-APR-2014) to the INSDC. RL Contact:Tsuyoshi Takano Atmosphere and Ocean Research Institute, University RL of Tokyo, Department of Marine Ecosystems Dynamics; 5-1-5 Kashiwanoha, RL Kashiwa, Chiba 277-8564, Japan XX RN [2] RC DOI:10.1016/j.ympev.2014.06.021 RX DOI; 10.1016/j.ympev.2014.06.021. RX PUBMED; 24994027. RA Takano T., Kano Y.; RT "Molecular phylogenetic investigations of the relationships of the RT echinoderm-parasite family Eulimidae within Hypsogastropoda (Mollusca)"; RL Mol. Phylogenet. Evol. 79:258-269(2014). XX DR MD5; f6ee3468f96d3623fe15a6b9dbf26f1f. XX FH Key Location/Qualifiers FH FT source 1..314 FT /organism="Opaliopsis sp. TT-2014" FT /isolate="YK1775" FT /mol_type="genomic DNA" FT /country="New Caledonia:Recif Petrie" FT /specimen_voucher="MNHN:IM:2009-24069" FT /db_xref="taxon:1502610" FT CDS <1..>314 FT /codon_start=1 FT /transl_table=1 FT /gene="H3" FT /product="histone H3" FT /db_xref="GOA:A0A068Q7A7" FT /db_xref="InterPro:IPR000164" FT /db_xref="InterPro:IPR007125" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A068Q7A7" FT /protein_id="BAP16166.1" FT /translation="RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIR FT RYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCA FT " XX SQ Sequence 314 BP; 76 A; 96 C; 82 G; 60 T; 0 other; agaaagtcga caggaggaaa ggctcctcgc aaacagctgg ccaccaaggc tgctcgtaag 60 agtgcccctg ccacaggagg tgtcaagaaa ccccatcgtt acaggcctgg cacagtcgct 120 cttcgtgaaa tccgtcgtta ccagaagagc actgaactgc tgatccgcaa gctgccattc 180 cagcgcctgg tgcgtgagat cgcgcaagat ttcaagaccg acctgcgctt ccaaagctct 240 gctgtcatgg ctctccagga agccagcgaa gcttaccttg tcggcctgtt cgaagacacc 300 aacttgtgcg ccat 314 //