ID AB828381; SV 2; linear; genomic DNA; STD; INV; 253 BP. XX AC AB828381; XX DT 07-AUG-2013 (Rel. 117, Created) DT 28-NOV-2013 (Rel. 119, Last updated, Version 2) XX DE Crematogaster fraxatrix mitochondrial COI gene for cytochrome oxidase DE subunit 1, partial cds, isolate: KUMANT002MLepF1LepR1. XX KW . XX OS Crematogaster fraxatrix OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Hymenoptera; Apocrita; Aculeata; Formicoidea; OC Formicidae; Myrmicinae; Crematogaster; Crematogaster. OG Mitochondrion XX RN [1] RP 1-253 RA Hosoishi S., Ogata K.; RT ; RL Submitted (25-JUN-2013) to the INSDC. RL Contact:Shingo Hosoishi Kyushu University, Institute of Tropical RL Agriculture; 6-10-1 Hakozaki, Higashi-ku, Fukuoka, Fukuoka 812-8581, Japan RL URL :http://bbs1.agr.kyushu-u.ac.jp/tropic/ XX RN [2] RA Hosoishi S.; RT "Description and DNA barcoding of Crematogaster fraxatrix and two new RT closely related species from Cambodia and Indonesia"; RL Unpublished. XX DR MD5; 5d15463be7fd746c258912ed7bb31920. XX FH Key Location/Qualifiers FH FT source 1..253 FT /organism="Crematogaster fraxatrix" FT /organelle="mitochondrion" FT /isolate="KUMANT002MLepF1LepR1" FT /mol_type="genomic DNA" FT /country="Malaysia:W. Malaysia, Selangor" FT /db_xref="taxon:1201983" FT CDS <1..>253 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:S6CDX3" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:S6CDX3" FT /protein_id="BAN67845.2" FT /translation="PLSSNLAHGGQSVDLSIFSLHIAGASSIMGSINFITTILNMQHKI FT FNMEIIPLFSWSMLLTAILLLLSLPVLAGAITMMLFDRN" XX SQ Sequence 253 BP; 71 A; 40 C; 28 G; 114 T; 0 other; ccattatcgt caaatcttgc ccatggtgga caatctgttg atttatcaat tttttctctt 60 catattgctg gggcttcttc aatcataggt tcaattaatt ttattactac tattttaaat 120 atacaacata aaatttttaa tatagaaatt attcctttat tttcatgatc tatattattg 180 acagctattc tattattgct ttctttacct gttttagcag gtgccattac tataatatta 240 tttgatcgga att 253 //