ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201834
CHEMBL1201834
Compound Name CANAKINUMAB
ChEMBL Synonyms CANAKINUMAB | ACZ-885 | ILARIS
Max Phase 4 (Approved)
Trade Names ILARIS

Sources

  • British National Formulary
  • Clinical Candidates
  • Manually Added Drugs
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1201834 compound icon
Drug Type:Antibody Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:N Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Interleukin-1 beta inhibitor Interleukin-1 beta DailyMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
Aortic Aneurysm, AbdominalD017544EFO:0004214Abdominal Aortic Aneurysm2ClinicalTrials
Diabetes MellitusD003920EFO:0000400diabetes mellitus2ClinicalTrials
Sarcoidosis, PulmonaryD017565DOID:13406pulmonary sarcoidosis2ClinicalTrials
Diabetic RetinopathyD003930EFO:0003770diabetic retinopathy1ClinicalTrials
UrticariaD014581EFO:0005531urticaria2ClinicalTrials
Carcinoma, Non-Small-Cell LungD002289EFO:0003060non-small cell lung carcinoma3ClinicalTrials
Cryopyrin-Associated Periodic SyndromesD056587Orphanet:1451CINCA syndrome4ClinicalTrials
Mevalonate Kinase DeficiencyD054078Orphanet:309025Mevalonate kinase deficiency4ClinicalTrials
DailyMed
PyodermaD011711HP:0000999pyoderma2ClinicalTrials
Familial Mediterranean FeverD010505Orphanet:342Familial Mediterranean fever4ClinicalTrials
DailyMed
OsteoarthritisD010003EFO:0002506osteoarthritis2ClinicalTrials
Diabetes Mellitus, Type 2D003924EFO:0001360type II diabetes mellitus2ClinicalTrials
Dry Eye SyndromesD015352EFO:1000906dry eye syndrome2ClinicalTrials
FeverD005334HP:0001945fever3ClinicalTrials
GoutD006073EFO:0004274gout3ClinicalTrials
Immune System DiseasesD007154EFO:0000540immune system disease4ATC
Pulmonary Disease, Chronic ObstructiveD029424EFO:0000341chronic obstructive pulmonary disease1ClinicalTrials
Arthritis, RheumatoidD001172EFO:0000685rheumatoid arthritis2ClinicalTrials
Peripheral Arterial DiseaseD058729EFO:0004265peripheral arterial disease2ClinicalTrials
Anemia, Sickle CellD000755Orphanet:232Sickle cell anemia2ClinicalTrials
AtherosclerosisD050197EFO:0003914atherosclerosis3ClinicalTrials
Atrial FibrillationD001281EFO:0000275atrial fibrillation2ClinicalTrials
Cryopyrin-Associated Periodic SyndromesD056587Orphanet:208650Cryopyrin-associated periodic syndrome4DailyMed
Macular DegenerationD008268EFO:0001365age-related macular degeneration1ClinicalTrials
Mucocutaneous Lymph Node SyndromeD009080EFO:0004246mucocutaneous lymph node syndrome2ClinicalTrials
Arthritis, JuvenileD001171EFO:0002609chronic childhood arthritis4ClinicalTrials
DailyMed
Diabetes Mellitus, Type 1D003922EFO:0001359type I diabetes mellitus2ClinicalTrials
Still's Disease, Adult-OnsetD016706EFO:0007135adult-onset Still's disease2ClinicalTrials

Clinical Data

ClinicalTrials.gov CANAKINUMAB
The Cochrane Collaboration CANAKINUMAB

HELM Notation

CHEMBL1201834 HELM Notation
PEPTIDE1{E.I.V.L.T.Q.S.P.D.F.Q.S.V.T.P.K.E.K.V.T.I.T.C.R.A.S.Q.S.I.G.S.S.L.H.W.Y.Q.Q.K.P.D.Q.S.P.K.L.L.I.K.Y.A.S.Q.S.F.S.G.V.P.S.R.F.S.G.S.G.S.G.T.D.F.T.L.T.I.N.S.L.E.A.E.D.A.A.A.Y.Y.C.H.Q.S.S.S.L.P.F.T.F.G.P.G.T.K.V.D.I.K.R.T.V.A.A.P.S.V.F.I.F.P.P.S.D.E.Q.L.K.S.G.T.A.S.V.V.C.L.L.N.N.F.Y.P.R.E.A.K.V.Q.W.K.V.D.N.A.L.Q.S.G.N.S.Q.E.S.V.T.E.Q.D.S.K.D.S.T.Y.S.L.S.S.T.L.T.L.S.K.A.D.Y.E.K.H.K.V.Y.A.C.E.V.T.H.Q.G.L.S.S.P.V.T.K.S.F.N.R.G.E.C}|PEPTIDE2{Q.V.Q.L.V.E.S.G.G.G.V.V.Q.P.G.R.S.L.R.L.S.C.A.A.S.G.F.T.F.S.V.Y.G.M.N.W.V.R.Q.A.P.G.K.G.L.E.W.V.A.I.I.W.Y.D.G.D.N.Q.Y.Y.A.D.S.V.K.G.R.F.T.I.S.R.D.N.S.K.N.T.L.Y.L.Q.M.N.G.L.R.A.E.D.T.A.V.Y.Y.C.A.R.D.L.R.T.G.P.F.D.Y.W.G.Q.G.T.L.V.T.V.S.S.A.S.T.K.G.P.S.V.F.P.L.A.P.S.S.K.S.T.S.G.G.T.A.A.L.G.C.L.V.K.D.Y.F.P.E.P.V.T.V.S.W.N.S.G.A.L.T.S.G.V.H.T.F.P.A.V.L.Q.S.S.G.L.Y.S.L.S.S.V.V.T.V.P.S.S.S.L.G.T.Q.T.Y.I.C.N.V.N.H.K.P.S.N.T.K.V.D.K.R.V.E.P.K.S.C.D.K.T.H.T.C.P.P.C.P.A.P.E.L.L.G.G.P.S.V.F.L.F.P.P.K.P.K.D.T.L.M.I.S.R.T.P.E.V.T.C.V.V.V.D.V.S.H.E.D.P.E.V.K.F.N.W.Y.V.D.G.V.E.V.H.N.A.K.T.K.P.R.E.E.Q.Y.N.S.T.Y.R.V.V.S.V.L.T.V.L.H.Q.D.W.L.N.G.K.E.Y.K.C.K.V.S.N.K.A.L.P.A.P.I.E.K.T.I.S.K.A.K.G.Q.P.R.E.P.Q.V.Y.T.L.P.P.S.R.E.E.M.T.K.N.Q.V.S.L.T.C.L.V.K.G.F.Y.P.S.D.I.A.V.E.W.E.S.N.G.Q.P.E.N.N.Y.K.T.T.P.P.V.L.D.S.D.G.S.F.F.L.Y.S.K.L.T.V.D.K.S.R.W.Q.Q.G.N.V.F.S.C.S.V.M.H.E.A.L.H.N.H.Y.T.Q.K.S.L.S.L.S.P.G.K}|PEPTIDE3{Q.V.Q.L.V.E.S.G.G.G.V.V.Q.P.G.R.S.L.R.L.S.C.A.A.S.G.F.T.F.S.V.Y.G.M.N.W.V.R.Q.A.P.G.K.G.L.E.W.V.A.I.I.W.Y.D.G.D.N.Q.Y.Y.A.D.S.V.K.G.R.F.T.I.S.R.D.N.S.K.N.T.L.Y.L.Q.M.N.G.L.R.A.E.D.T.A.V.Y.Y.C.A.R.D.L.R.T.G.P.F.D.Y.W.G.Q.G.T.L.V.T.V.S.S.A.S.T.K.G.P.S.V.F.P.L.A.P.S.S.K.S.T.S.G.G.T.A.A.L.G.C.L.V.K.D.Y.F.P.E.P.V.T.V.S.W.N.S.G.A.L.T.S.G.V.H.T.F.P.A.V.L.Q.S.S.G.L.Y.S.L.S.S.V.V.T.V.P.S.S.S.L.G.T.Q.T.Y.I.C.N.V.N.H.K.P.S.N.T.K.V.D.K.R.V.E.P.K.S.C.D.K.T.H.T.C.P.P.C.P.A.P.E.L.L.G.G.P.S.V.F.L.F.P.P.K.P.K.D.T.L.M.I.S.R.T.P.E.V.T.C.V.V.V.D.V.S.H.E.D.P.E.V.K.F.N.W.Y.V.D.G.V.E.V.H.N.A.K.T.K.P.R.E.E.Q.Y.N.S.T.Y.R.V.V.S.V.L.T.V.L.H.Q.D.W.L.N.G.K.E.Y.K.C.K.V.S.N.K.A.L.P.A.P.I.E.K.T.I.S.K.A.K.G.Q.P.R.E.P.Q.V.Y.T.L.P.P.S.R.E.E.M.T.K.N.Q.V.S.L.T.C.L.V.K.G.F.Y.P.S.D.I.A.V.E.W.E.S.N.G.Q.P.E.N.N.Y.K.T.T.P.P.V.L.D.S.D.G.S.F.F.L.Y.S.K.L.T.V.D.K.S.R.W.Q.Q.G.N.V.F.S.C.S.V.M.H.E.A.L.H.N.H.Y.T.Q.K.S.L.S.L.S.P.G.K}|PEPTIDE4{E.I.V.L.T.Q.S.P.D.F.Q.S.V.T.P.K.E.K.V.T.I.T.C.R.A.S.Q.S.I.G.S.S.L.H.W.Y.Q.Q.K.P.D.Q.S.P.K.L.L.I.K.Y.A.S.Q.S.F.S.G.V.P.S.R.F.S.G.S.G.S.G.T.D.F.T.L.T.I.N.S.L.E.A.E.D.A.A.A.Y.Y.C.H.Q.S.S.S.L.P.F.T.F.G.P.G.T.K.V.D.I.K.R.T.V.A.A.P.S.V.F.I.F.P.P.S.D.E.Q.L.K.S.G.T.A.S.V.V.C.L.L.N.N.F.Y.P.R.E.A.K.V.Q.W.K.V.D.N.A.L.Q.S.G.N.S.Q.E.S.V.T.E.Q.D.S.K.D.S.T.Y.S.L.S.S.T.L.T.L.S.K.A.D.Y.E.K.H.K.V.Y.A.C.E.V.T.H.Q.G.L.S.S.P.V.T.K.S.F.N.R.G.E.C}$PEPTIDE3,PEPTIDE3,368:R3-426:R3|PEPTIDE3,PEPTIDE3,22:R3-96:R3|PEPTIDE3,PEPTIDE4,221:R3-214:R3|PEPTIDE4,PEPTIDE4,23:R3-88:R3|PEPTIDE2,PEPTIDE2,262:R3-322:R3|PEPTIDE3,PEPTIDE3,145:R3-201:R3|PEPTIDE1,PEPTIDE1,134:R3-194:R3|PEPTIDE2,PEPTIDE2,368:R3-426:R3|PEPTIDE2,PEPTIDE3,230:R3-230:R3|PEPTIDE3,PEPTIDE3,262:R3-322:R3|PEPTIDE2,PEPTIDE2,145:R3-201:R3|PEPTIDE4,PEPTIDE4,134:R3-194:R3|PEPTIDE2,PEPTIDE2,22:R3-96:R3|PEPTIDE2,PEPTIDE1,221:R3-214:R3|PEPTIDE2,PEPTIDE3,227:R3-227:R3|PEPTIDE1,PEPTIDE1,23:R3-88:R3$$$

The ChEMBL HELM monomer library is available to download here.

For more details about HELM Notation, please visit the HELM Homepage.

Biological Sequence

Description Sequence
Canakinumab heavy chain QVQLVESGGGVVQPGRSLRLSCAASGFTFSVYGMNWVRQAPGKGLEWVAIIWYDGDNQYY ADSVKGRFTISRDNSKNTLYLQMNGLRAEDTAVYYCARDLRTGPFDYWGQGTLVTVSSAS TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPS VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSPGK
Canakinumab light chain EIVLTQSPDFQSVTPKEKVTITCRASQSIGSSLHWYQQKPDQSPKLLIKYASQSFSGVPS RFSGSGSGTDFTLTINSLEAEDAAAYYCHQSSSLPFTFGPGTKVDIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Compound Cross References

ATC L - ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS
L04 - IMMUNOSUPPRESSANTS
L04A - IMMUNOSUPPRESSANTS
L04AC - Interleukin inhibitors
L04AC08 - canakinumab

ChemSpider ChemSpider Identifier not yet assigned
DailyMed canakinumab
Wikipedia Canakinumab
spacer
spacer