ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201830
CHEMBL1201830
Compound Name RILONACEPT
ChEMBL Synonyms RILONACEPT | ARCALYST | IL-1 TRAP | INTERLEUKIN-1 TRAP
Max Phase 4 (Approved)
Trade Names ARCALYST

Sources

  • Clinical Candidates
  • Manually Added Drugs
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1201830 compound icon
Drug Type:Oligopeptide Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:N Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Interleukin-1 beta inhibitor Interleukin-1 beta DailyMed PubMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
Hearing LossD034381EFO:0004238hearing loss0ClinicalTrials
GoutD006073EFO:0004274gout3ClinicalTrials
Cryopyrin-Associated Periodic SyndromesD056587Orphanet:208650Cryopyrin-associated periodic syndrome4DailyMed
Hepatitis, AlcoholicD006519EFO:1001345Hepatitis, Alcoholic2ClinicalTrials
Arthritis, JuvenileD001171EFO:0002609chronic childhood arthritis2ClinicalTrials
Immune System DiseasesD007154EFO:0000540immune system disease4ATC
Cryopyrin-Associated Periodic SyndromesD056587Orphanet:47045Familial cold urticaria4DailyMed
Diabetes Mellitus, Type 1D003922EFO:0001359type I diabetes mellitus1ClinicalTrials
Familial Mediterranean FeverD010505Orphanet:342Familial Mediterranean fever2ClinicalTrials
Cryopyrin-Associated Periodic SyndromesD056587Orphanet:575Muckle-Wells syndrome4DailyMed

Clinical Data

ClinicalTrials.gov RILONACEPT
The Cochrane Collaboration RILONACEPT

Biological Sequence

Description Sequence
Riloacept fusion protein SERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYSTAHSAGLTLIWYWTRQDRDLE EPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSCFNS PMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMGCYKIQNFNNVIPEGMNLSFL IALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNAVPPVIHSPNDHVVYEKEPGE ELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDITIDVTINESISHSRTEDETRTQILSIKK VTSEDLKRSYVCHARSAKGEVAKAAKVKQKVPAPRYTVEKCKEREEKIILVSSANEIDVR PCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSS YCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYK DCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENK PTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVE NPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNSGDKTHTCP PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNA KTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQ VYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Compound Cross References

ATC L - ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS
L04 - IMMUNOSUPPRESSANTS
L04A - IMMUNOSUPPRESSANTS
L04AC - Interleukin inhibitors
L04AC04 - rilonacept

ChemSpider ChemSpider Identifier not yet assigned
DailyMed rilonacept
Wikipedia Rilonacept
spacer
spacer