ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201825
CHEMBL1201825
Compound Name RANIBIZUMAB
ChEMBL Synonyms Lucentis | RG-3645 | RHUFAB | S01LA04 | RANIBIZUMAB | FAB-12 VARIANT Y0317
Max Phase 4 (Approved)
Trade Names Lucentis

Molecule Features

CHEMBL1201825 compound icon
Drug Type:mAB Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:N Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Vascular endothelial growth factor A inhibitor Vascular endothelial growth factor A DailyMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication
DIABETES MELLITUSD003920EFO:0000400DIABETES MELLITUS2
DIABETIC RETINOPATHYD003930EFO:0003770DIABETIC RETINOPATHY4
GLAUCOMAD005901EFO:0000516GLAUCOMA2
HISTOPLASMOSISD006660EFO:0007310HISTOPLASMOSIS4
MACULAR DEGENERATIOND008268EFO:0001365AGE-RELATED MACULAR DEGENERATION4
MACULAR EDEMAD008269HP:0011505CYSTOID MACULAR EDEMA4
MACULAR EDEMAD008269HP:0040049MACULAR EDEMA4
MELANOMAD008545EFO:0000756MELANOMA2
MYOPIAD009216HP:0000545MYOPIA3
PTERYGIUMD011625EFO:0000678PTERYGIUM2
RETINAL DISEASESD012164EFO:0003839RETINOPATHY4
RETINAL NEOVASCULARIZATIOND015861EFO:0005753OCULAR VASCULAR DISORDER4
WET MACULAR DEGENERATIOND057135EFO:0004683WET MACULAR DEGENERATION4

Clinical Data

Number of clinical trials registered at clinicaltrials.gov
Number of reviews at The Cochrane Collaboration
Number of entries at British National Formulary

Biological Sequence

Description Sequence
Ranibizumab fab fragment DIQLTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQKPGKAPKVLIYFTSSLHSGVPS RFSGSGSGTDFTLTISSLQPEDFATYYCQQYSTVPWTFGQGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGE
Ranibizumab light chain EVQLVESGGGLVQPGGSLRLSCAASGYDFTHYGMNWVRQAPGKGLEWVGWINTYTGEPTY AADFKRRFTFSLDTSKSTAYLQMNSLRAEDTAVYYCAKYPYYYGTSHWYFDVWGQGTLVT VSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK

Compound Cross References

ATC S - SENSORY ORGANS
S01 - OPHTHALMOLOGICALS
S01L - OCULAR VASCULAR DISORDER AGENTS
S01LA - Antineovascularisation agents
S01LA04 - ranibizumab

ChemSpider ChemSpider Identifier not yet assigned
DailyMed ranibizumab
Wikipedia Ranibizumab
spacer
spacer