ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201825
CHEMBL1201825
Compound Name RANIBIZUMAB
ChEMBL Synonyms RG-3645 | FAB-12 VARIANT Y0317 | LUCENTIS | RANIBIZUMAB | RHUFAB
Max Phase 4 (Approved)
Trade Names LUCENTIS

Sources

  • British National Formulary
  • Clinical Candidates
  • Manually Added Drugs
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1201825 compound icon
Drug Type:Antibody Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:N Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Vascular endothelial growth factor A inhibitor Vascular endothelial growth factor A DailyMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
Angioid StreaksD000793EFO:1000805angioid streaks1ClinicalTrials
Retinal DetachmentD012163EFO:0005773retinal detachment2ClinicalTrials
Diabetes MellitusD003920EFO:0000400diabetes mellitus2ClinicalTrials
Macular EdemaD0082694ClinicalTrials
ClinicalTrials
DailyMed
Optic Neuropathy, IschemicD018917EFO:1000809anterior ischemic optic neuropathy1ClinicalTrials
Retinal NeovascularizationD015861EFO:0005753ocular vascular disease4ATC
Glaucoma, Open-AngleD005902EFO:0004190open-angle glaucoma1ClinicalTrials
Retinal DiseasesD012164EFO:0003839retinopathy2ClinicalTrials
Retinal Vein OcclusionD012170EFO:1001157retinal vein occlusion3ClinicalTrials
Corneal NeovascularizationD016510EFO:1000880corneal neovascularization1ClinicalTrials
Glaucoma, NeovascularD015355EFO:1001060neovascular glaucoma3ClinicalTrials
HistoplasmosisD006660EFO:0007310histoplasmosis2ClinicalTrials
MyopiaD009216HP:0000545Myopia1ClinicalTrials
Diabetic RetinopathyD003930EFO:0003770diabetic retinopathy4ClinicalTrials
DailyMed
Macular DegenerationD008268EFO:0001365age-related macular degeneration3ClinicalTrials
MelanomaD008545EFO:0000756melanoma3ClinicalTrials
PterygiumD011625EFO:0000678pterygium2ClinicalTrials
RetinoblastomaD012175Orphanet:790Retinoblastoma2ClinicalTrials
Wet Macular DegenerationD057135EFO:0004683wet macular degeneration4ClinicalTrials
DailyMed
von Hippel-Lindau DiseaseD006623Orphanet:892Von Hippel-Lindau disease1ClinicalTrials
GlaucomaD005901EFO:0000516glaucoma3ClinicalTrials
Myopia, DegenerativeD047728EFO:0004207pathological myopia3ClinicalTrials
Retinopathy of PrematurityD012178EFO:1001158retinopathy of prematurity3ClinicalTrials

Clinical Data

ClinicalTrials.gov RANIBIZUMAB
The Cochrane Collaboration RANIBIZUMAB

Biological Sequence

Description Sequence
Ranibizumab fab fragment DIQLTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQKPGKAPKVLIYFTSSLHSGVPS RFSGSGSGTDFTLTISSLQPEDFATYYCQQYSTVPWTFGQGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGE
Ranibizumab light chain EVQLVESGGGLVQPGGSLRLSCAASGYDFTHYGMNWVRQAPGKGLEWVGWINTYTGEPTY AADFKRRFTFSLDTSKSTAYLQMNSLRAEDTAVYYCAKYPYYYGTSHWYFDVWGQGTLVT VSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK

Compound Cross References

ATC S - SENSORY ORGANS
S01 - OPHTHALMOLOGICALS
S01L - OCULAR VASCULAR DISORDER AGENTS
S01LA - Antineovascularisation agents
S01LA04 - ranibizumab

ChemSpider ChemSpider Identifier not yet assigned
DailyMed ranibizumab
Wikipedia Ranibizumab
spacer
spacer