ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201821
CHEMBL1201821
Compound Name PALIFERMIN
ChEMBL Synonyms PALIFERMIN | KEPIVANCE
Max Phase 4 (Approved)
Trade Names KEPIVANCE

Sources

  • British National Formulary
  • Manually Added Drugs
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1201821 compound icon
Drug Type:Oligopeptide Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:N Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Fibroblast growth factor receptor 2 agonist Fibroblast growth factor receptor 2 FDA PubMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
AsthmaD001249EFO:0000270asthma2ClinicalTrials
Graft vs Host DiseaseD006086EFO:0004599acute graft vs. host disease1ClinicalTrials
Leukemia, Myeloid, AcuteD015470EFO:0000222acute myeloid leukemia2ClinicalTrials
Leukemia, Plasma CellD007952EFO:0006475plasma cell leukemia1ClinicalTrials
Multiple MyelomaD009101EFO:0001378multiple myeloma3ClinicalTrials
MucositisD052016EFO:1001898mucositis3ClinicalTrials
Multiple SclerosisD009103EFO:0003885multiple sclerosis1ClinicalTrials
Stevens-Johnson SyndromeD013262EFO:0004775toxic epidermal necrolysis1ClinicalTrials
Hodgkin DiseaseD006689EFO:0000183Hodgkins lymphoma1ClinicalTrials
Head and Neck NeoplasmsD006258EFO:0006859head and neck malignant neoplasia3ClinicalTrials
NeoplasmsD009369EFO:0000616neoplasm0ClinicalTrials
StomatitisD013280EFO:1001904oral mucositis3ClinicalTrials
X-Linked Combined Immunodeficiency DiseasesD053632EFO:1001451X-Linked Combined Immunodeficiency Diseases1ClinicalTrials
HIV InfectionsD015658EFO:0000764HIV infection2ClinicalTrials
LeukemiaD007938EFO:0000565leukemia3ClinicalTrials
LymphomaD008223EFO:0000574lymphoma3ClinicalTrials
Myelodysplastic SyndromesD009190EFO:0000198myelodysplastic syndrome2ClinicalTrials
Colonic NeoplasmsD003110EFO:1001950colon carcinoma2ClinicalTrials
Lymphoma, Non-HodgkinD008228EFO:0005952non-Hodgkins lymphoma2ClinicalTrials
Stevens-Johnson SyndromeD013262EFO:0004276Stevens-Johnson syndrome1ClinicalTrials

Clinical Data

ClinicalTrials.gov PALIFERMIN
The Cochrane Collaboration PALIFERMIN

Biological Sequence

Description Sequence
[23-methionine]-23-163-fibroblast growth factor 7 MSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGV ESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIP VRGKKTKKEQKTAHFLPMAIT

Compound Cross References

ATC V - VARIOUS
V03 - ALL OTHER THERAPEUTIC PRODUCTS
V03A - ALL OTHER THERAPEUTIC PRODUCTS
V03AF - Detoxifying agents for antineoplastic treatment
V03AF08 - palifermin

ChemSpider ChemSpider Identifier not yet assigned
DailyMed palifermin
Wikipedia Palifermin
spacer
spacer