ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201670
CHEMBL1201670
Compound Name SARGRAMOSTIM
ChEMBL Synonyms LEUKINE | SARGRAMOSTIM | B1 61.012 | RHU GM-CSF
Max Phase 4 (Approved)
Trade Names LEUKINE

Sources

  • Manually Added Drugs
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1201670 compound icon
Drug Type:Oligopeptide Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:N Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Granulocyte-macrophage colony-stimulating factor receptor agonist Granulocyte-macrophage colony-stimulating factor receptor DailyMed PubMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
Crohn DiseaseD003424EFO:0000384Crohn's disease3ClinicalTrials
Esophageal NeoplasmsD004938EFO:0002916esophageal carcinoma2ClinicalTrials
GliosarcomaD018316EFO:1001465gliosarcoma2ClinicalTrials
Head and Neck NeoplasmsD006258EFO:0006859head and neck malignant neoplasia3ClinicalTrials
Hepatitis B, ChronicD019694EFO:0004239chronic hepatitis B infection1ClinicalTrials
InfectionD007239EFO:0000544infection3ClinicalTrials
Leukemia, Plasma CellD007952EFO:0006475plasma cell leukemia1ClinicalTrials
Multiple MyelomaD009101EFO:0001378multiple myeloma3ClinicalTrials
Myelodysplastic SyndromesD009190EFO:0000198myelodysplastic syndrome2ClinicalTrials
Pancreatic NeoplasmsD010190EFO:0002618pancreatic carcinoma3ClinicalTrials
Parkinson DiseaseD010300EFO:0002508Parkinson's disease1ClinicalTrials
SepsisD018805HP:0100806sepsis2ClinicalTrials
Anemia, Refractory, with Excess of BlastsD000754EFO:0003811refractory anemia with excess blasts1ClinicalTrials
GliomaD005910EFO:0000326central nervous system cancer2ClinicalTrials
Leukemia, Myeloid, AcuteD015470EFO:0000222acute myeloid leukemia2ClinicalTrials
Prostatic NeoplasmsD011471EFO:0001663prostate carcinoma3ClinicalTrials
RhabdomyosarcomaD012208EFO:0002918rhabdomyosarcoma2ClinicalTrials
SarcomaD012509EFO:0000691sarcoma3ClinicalTrials
AdenocarcinomaD000230EFO:0000228adenocarcinoma2ClinicalTrials
Biliary Tract NeoplasmsD001661EFO:0003891biliary tract neoplasm2ClinicalTrials
Carcinoma, DuctalD044584EFO:0000430ductal adenocarcinoma2ClinicalTrials
Carcinoma, Renal CellD002292EFO:0000681renal cell carcinoma3ClinicalTrials
HIV InfectionsD015658EFO:0000180HIV-1 infection2ClinicalTrials
Inflammatory Breast NeoplasmsD058922EFO:1000984inflammatory breast carcinoma2ClinicalTrials
Kidney DiseasesD007674EFO:0003086kidney disease2ClinicalTrials
PeriodontitisD010518EFO:0000649periodontitis1ClinicalTrials
Respiratory Distress Syndrome, AdultD012128EFO:1000637acute respiratory distress syndrome2ClinicalTrials
Urinary Bladder NeoplasmsD001749EFO:0000292bladder carcinoma3ClinicalTrials
Bile Duct NeoplasmsD001650EFO:0005540bile duct carcinoma2ClinicalTrials
Carcinoma, HepatocellularD006528EFO:0000182hepatocellular carcinoma1ClinicalTrials
Carcinoma, Non-Small-Cell LungD002289EFO:0003060non-small cell lung carcinoma2ClinicalTrials
LeukemiaD007938EFO:0000565leukemia3ClinicalTrials
Leukemia, Lymphocytic, Chronic, B-CellD015451EFO:0000095chronic lymphocytic leukemia2ClinicalTrials
LymphomaD008223EFO:0000574lymphoma3ClinicalTrials
Lymphoma, Mantle-CellD020522EFO:1001469Mantle cell lymphoma2ClinicalTrials
NeuroblastomaD009447EFO:0000621neuroblastoma3ClinicalTrials
Peripheral Arterial DiseaseD058729EFO:0004265peripheral arterial disease2ClinicalTrials
Prostatic NeoplasmsD011471EFO:0000673prostate adenocarcinoma3ClinicalTrials
Alzheimer DiseaseD000544EFO:0000249Alzheimers disease2ClinicalTrials
Breast NeoplasmsD001943EFO:0000305breast carcinoma3ClinicalTrials
Breast NeoplasmsD001943EFO:0003869breast neoplasm3ClinicalTrials
Carcinoma, Renal CellD002292EFO:0002890renal carcinoma3ClinicalTrials
Colorectal NeoplasmsD015179EFO:1001951colorectal carcinoma2ClinicalTrials
Leukemia, Myelogenous, Chronic, BCR-ABL PositiveD015464EFO:0000339chronic myelogenous leukemia3ClinicalTrials
Lymphoma, Non-HodgkinD008228EFO:0005952non-Hodgkins lymphoma3ClinicalTrials
MelanomaD008545EFO:0000389cutaneous melanoma3ClinicalTrials
Ovarian NeoplasmsD010051EFO:0001075ovarian carcinoma2ClinicalTrials
Ovarian NeoplasmsD010051EFO:0003893ovarian neoplasm2ClinicalTrials
Pulmonary Alveolar ProteinosisD011649Orphanet:264675Congenital pulmonary alveolar proteinosis2ClinicalTrials
Arthritis, RheumatoidD001172EFO:0000685rheumatoid arthritis1ClinicalTrials
Burkitt LymphomaD002051EFO:0000309Burkitts lymphoma2ClinicalTrials
Gallbladder NeoplasmsD005706EFO:1001956gallbladder carcinoma2ClinicalTrials
Hematologic DiseasesD006402HP:0001871abnormality of blood and blood-forming tissues2ClinicalTrials
Leukemia, LymphoidD007945EFO:0004289lymphoid leukemia2ClinicalTrials
Lung NeoplasmsD008175EFO:0001071lung carcinoma1ClinicalTrials
Myasthenia GravisD009157EFO:0004991Myasthenia gravis0ClinicalTrials
NeoplasmsD009369EFO:0000616neoplasm2ClinicalTrials
Breast Neoplasms, MaleD018567EFO:0006861male breast carcinoma2ClinicalTrials
Lymphoma, FollicularD008224EFO:0000096neoplasm of mature B-cells2ClinicalTrials
MelanomaD008545EFO:0002617metastatic melanoma3ClinicalTrials
NeoplasmsD009369EFO:0000311cancer2ClinicalTrials
OsteosarcomaD012516EFO:0000637osteosarcoma2ClinicalTrials
HIV InfectionsD015658EFO:0000764HIV infection2ClinicalTrials
Leishmaniasis, CutaneousD016773EFO:0005046cutaneous Leishmaniasis3ClinicalTrials
Lymphoma, Large B-Cell, DiffuseD016403EFO:0000403diffuse large B-cell lymphoma2ClinicalTrials
MelanomaD008545EFO:0000756melanoma3ClinicalTrials
Pulmonary Alveolar ProteinosisD011649HP:0006517Alveolar proteinosis2ClinicalTrials
Stomach NeoplasmsD013274EFO:0000178gastric carcinoma2ClinicalTrials

Clinical Data

ClinicalTrials.gov SARGRAMOSTIM
The Cochrane Collaboration SARGRAMOSTIM

Biological Sequence

Description Sequence
Granulocyte-macrophage colony-stimulating factor APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLE LYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFD CWEPVQE

Compound Cross References

ATC L - ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS
L03 - IMMUNOSTIMULANTS
L03A - IMMUNOSTIMULANTS
L03AA - Colony stimulating factors
L03AA09 - sargramostim

ChemSpider ChemSpider Identifier not yet assigned
DailyMed sargramostim
Wikipedia Sargramostim
spacer
spacer