ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201608
CHEMBL1201608
Compound Name MUROMONAB-CD3
ChEMBL Synonyms ORTHOCLONE OKT3 | MUROMONAB-CD3 | OKT-3
Max Phase 4 (Approved)
Trade Names ORTHOCLONE OKT3

Sources

  • Clinical Candidates
  • Manually Added Drugs
  • Scientific Literature
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1201608 compound icon
Drug Type:Antibody Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:Y Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
T cell surface glycoprotein CD3 inhibitor T cell surface glycoprotein CD3 DailyMed PubMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
GliomaD005910EFO:0000326central nervous system cancer2ClinicalTrials
MelanomaD008545EFO:0000756melanoma2ClinicalTrials
Carcinoma, Renal CellD002292EFO:0002890renal carcinoma2ClinicalTrials
Colitis, UlcerativeD003093EFO:0000729ulcerative colitis1ClinicalTrials
NeoplasmsD009369EFO:0000616neoplasm1ClinicalTrials
Immune System DiseasesD007154EFO:0000540immune system disease4ATC
MelanomaD008545EFO:0000389cutaneous melanoma2ClinicalTrials
Kidney NeoplasmsD007680EFO:0003865kidney neoplasm1ClinicalTrials
NeoplasmsD009369EFO:0000311cancer1ClinicalTrials
Non-alcoholic Fatty Liver DiseaseD065626EFO:1001249non-alcoholic steatohepatitis2ClinicalTrials

Clinical Data

ClinicalTrials.gov MUROMONAB-CD3
The Cochrane Collaboration MUROMONAB-CD3

Biological Sequence

Description Sequence
Muromonab-CD3 heavy chain QVQLQQSGAELARPGASVKMSCKASGYTFTRYTMHWVKQRPGQGLEWIGYINPSRGYTNY NQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYYDDHYCLDYWGQGTTLTVSSA KTTAPSVYPLAPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Muromonab-CD3 light chain QIVLTQSPAIMSASPGEKVTMTCSASSSVSYMNWYQQKSGTSPKRWIYDTSKLASGVPAH FRGSGSGTSYSLTISGMEAEDAATYYCQQWSSNPFTFGSGTKLEINRADTAPTVSIFPPS SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL TKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Compound Bioactivity Summary

Compound Assay Summary

Compound Target Summary

Compound Cross References

ATC L - ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS
L04 - IMMUNOSUPPRESSANTS
L04A - IMMUNOSUPPRESSANTS
L04AA - Selective immunosuppressants
L04AA02 - muromonab-CD3

ChemSpider ChemSpider Identifier not yet assigned
DailyMed muromonab-cd3
Wikipedia Muromonab-CD3
spacer
spacer