ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201594
CHEMBL1201594
Compound Name RASBURICASE
ChEMBL Synonyms ELITEK | SR29142 | RASBURICASE | FASTURTEC
Max Phase 4 (Approved)
Trade Names FASTURTEC | ELITEK

Sources

  • British National Formulary
  • Manually Added Drugs
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1201594 compound icon
Drug Type:Enzyme Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:Y Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Uric acid oxidative enzyme Uric acid DailyMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
LeukemiaD007938EFO:0000565leukemia2ClinicalTrials
Lymphoma, Large B-Cell, DiffuseD016403EFO:0000403diffuse large B-cell lymphoma2ClinicalTrials
Burkitt LymphomaD002051EFO:0000309Burkitts lymphoma2ClinicalTrials
Lymphoma, Large-Cell, AnaplasticD017728EFO:0003032anaplastic large cell lymphoma2ClinicalTrials
LymphomaD008223EFO:0000574lymphoma3ClinicalTrials
Tumor Lysis SyndromeD015275EFO:1001479Tumor Lysis Syndrome2ClinicalTrials
Precursor Cell Lymphoblastic Leukemia-LymphomaD054198EFO:0000220acute lymphoblastic leukemia3ClinicalTrials
HyperuricemiaD0334613ClinicalTrials

Clinical Data

ClinicalTrials.gov RASBURICASE
The Cochrane Collaboration RASBURICASE

Biological Sequence

Description Sequence
Uricase SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKADNSVIVATDSI KNTIYITAKQNPVTPPELFGSILGTHFIEKYNHIHAAHVNIVCHRWTRMDIDGKPHPHSF IRDSEEKRNVQVDVVEGKGIDIKSSLSGLTVLKSTNSQFWGFLRDEYTTLKETWDRILST DVDATWQWKNFSGLQEVRSHVPKFDATWATAREVTLKTFAEDNSASVQATMYKMAEQILA RQQLIETVEYSLPNKHYFEIDLSWHKGLQNTGKNAEVFAPQSDPNGLIKCTVGRSSLKSK L

Compound Cross References

ATC V - VARIOUS
V03 - ALL OTHER THERAPEUTIC PRODUCTS
V03A - ALL OTHER THERAPEUTIC PRODUCTS
V03AF - Detoxifying agents for antineoplastic treatment
V03AF07 - rasburicase

ChemSpider ChemSpider Identifier not yet assigned
DailyMed rasburicase
Wikipedia Rasburicase
spacer
spacer