ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201584
CHEMBL1201584
Compound Name ABCIXIMAB
ChEMBL Synonyms REOPRO | C7E3 | ABCIXIMAB
Max Phase 4 (Approved)
Trade Names REOPRO

Sources

  • British National Formulary
  • Clinical Candidates
  • Manually Added Drugs
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1201584 compound icon
Drug Type:Antibody Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:N Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Integrin alpha-IIb/beta-3 inhibitor Integrin alpha-IIb/beta-3 DailyMed
Integrin alpha-V/beta-3 inhibitor Integrin alpha-V/beta-3 DailyMed PubMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
Carotid StenosisD016893EFO:0002615internal carotid artery stenosis1ClinicalTrials
Angina, UnstableD000789EFO:1000985intermediate coronary syndrome4ClinicalTrials
DailyMed
ThrombosisD013927HP:0004419Recurrent thrombophlebitis4ATC
Arterial Occlusive DiseasesD0011572ClinicalTrials
Angina, StableD060050EFO:0003913angina pectoris2ClinicalTrials
Myocardial InfarctionD009203EFO:0000612myocardial infarction3ClinicalTrials
StrokeD020521EFO:0000712stroke3ClinicalTrials

Clinical Data

ClinicalTrials.gov ABCIXIMAB
The Cochrane Collaboration ABCIXIMAB

Biological Sequence

Description Sequence
Abciximab heavy chain EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKY DPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSA KTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Abciximab light chain DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPS RFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPP SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Compound Cross References

ATC B - BLOOD AND BLOOD FORMING ORGANS
B01 - ANTITHROMBOTIC AGENTS
B01A - ANTITHROMBOTIC AGENTS
B01AC - Platelet aggregation inhibitors excl. heparin
B01AC13 - abciximab

ChemSpider ChemSpider Identifier not yet assigned
DailyMed abciximab
Wikipedia Abciximab
spacer
spacer