ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201576
CHEMBL1201576
Compound Name RITUXIMAB
ChEMBL Synonyms RITUXAN | MABTHERA RITUXAN | RITUXIMAB | IDEC-102 | MABTHERA | IDEC-C2B8 | RG-105 | R-105 IDEC-102
Max Phase 4 (Approved)
Trade Names MABTHERA | MABTHERA RITUXAN | RITUXAN

Sources

  • British National Formulary
  • Clinical Candidates
  • Gene Expression Atlas Compounds
  • Manually Added Drugs
  • Scientific Literature
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1201576 compound icon
Drug Type:Antibody Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:Y Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
B-lymphocyte antigen CD20 inhibitor B-lymphocyte antigen CD20 DailyMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
Arthritis, RheumatoidD001172EFO:0000685rheumatoid arthritis4ClinicalTrials
DailyMed
Autoimmune DiseasesD001327EFO:0005140autoimmune disease1ClinicalTrials
Lupus Erythematosus, SystemicD008180EFO:0002690systemic lupus erythematosus3ClinicalTrials
LymphomaD008223EFO:0000574lymphoma3ClinicalTrials
MelanomaD008545EFO:0000389cutaneous melanoma2ClinicalTrials
MelanomaD008545EFO:0002617metastatic melanoma2ClinicalTrials
Multiple MyelomaD009101EFO:0001378multiple myeloma2ClinicalTrials
Pancreatic NeoplasmsD010190EFO:0003860pancreatic neoplasm2ClinicalTrials
Pemphigoid, Benign Mucous MembraneD010390EFO:1000680cicatricial pemphigoid1ClinicalTrials
PemphigusD010392EFO:0004719pemphigus vulgaris3ClinicalTrials
Purpura, Thrombocytopenic, IdiopathicD016553EFO:0007160autoimmune thrombocytopenic purpura3ClinicalTrials
Anemia, Hemolytic, AutoimmuneD000744EFO:1001264Anemia, Hemolytic, Autoimmune3ClinicalTrials
Antiphospholipid SyndromeD016736EFO:0002689antiphospholipid syndrome2ClinicalTrials
Arthritis, PsoriaticD015535EFO:0003778psoriatic arthritis1ClinicalTrials
Colitis, UlcerativeD003093EFO:0000729ulcerative colitis2ClinicalTrials
Heart FailureD006333EFO:0003144heart failure2ClinicalTrials
Hemophilia AD006467Orphanet:98878Hemophilia A3ClinicalTrials
Hodgkin DiseaseD006689EFO:0000183Hodgkins lymphoma3ClinicalTrials
Kidney DiseasesD007674EFO:0003086kidney disease3ClinicalTrials
Leukemia, Hairy CellD007943EFO:1000956hairy cell leukemia2ClinicalTrials
Lymphoma, Large-Cell, AnaplasticD017728EFO:0003032anaplastic large cell lymphoma2ClinicalTrials
Myasthenia GravisD009157EFO:0004991Myasthenia gravis3ClinicalTrials
NeuroblastomaD009447EFO:0000621neuroblastoma0ClinicalTrials
Peripheral Nervous System DiseasesD010523EFO:0003100peripheral neuropathy3ClinicalTrials
Pneumococcal InfectionsD011008EFO:0000772pneumococcal infection2ClinicalTrials
Prostatic NeoplasmsD011471EFO:0001663prostate carcinoma0ClinicalTrials
Stiff-Person SyndromeD016750EFO:0007498Stiff-Person syndrome2ClinicalTrials
UrticariaD014581EFO:0005531urticaria1ClinicalTrials
Glomerulonephritis, MembranousD015433EFO:0004254membranous glomerulonephritis3ClinicalTrials
Graft vs Host DiseaseD006086EFO:0004599acute graft vs. host disease3ClinicalTrials
Graves OphthalmopathyD049970EFO:1001466Graves ophthalmopathy2ClinicalTrials
Idiopathic Pulmonary FibrosisD054990EFO:0000768idiopathic pulmonary fibrosis2ClinicalTrials
Leukemia, Myelogenous, Chronic, BCR-ABL PositiveD015464EFO:0000339chronic myelogenous leukemia2ClinicalTrials
Macular DegenerationD008268EFO:0001365age-related macular degeneration1ClinicalTrials
PolymyositisD017285EFO:0003063polymyositis2ClinicalTrials
Burkitt LymphomaD002051EFO:0000309Burkitts lymphoma3ClinicalTrials
Churg-Strauss SyndromeD015267EFO:0007208Churg-Strauss syndrome2ClinicalTrials
Colonic NeoplasmsD003110EFO:0004288colonic neoplasm2ClinicalTrials
DermatomyositisD003882EFO:0000557juvenile dermatomyositis2ClinicalTrials
Encephalitis, JapaneseD004672EFO:0007332Japanese encephalitis2ClinicalTrials
Hematologic NeoplasmsD019337EFO:0001642lymphoid neoplasm2ClinicalTrials
Leukemia, Lymphocytic, Chronic, B-CellD015451EFO:0000095chronic lymphocytic leukemia4ClinicalTrials
Leukemia, Mast-CellD007946EFO:0007359mast-cell leukemia2ClinicalTrials
Lymphoma, B-Cell, Marginal ZoneD018442EFO:1000630marginal zone B-cell lymphoma3ClinicalTrials
Pemphigoid, BullousD010391EFO:0007187bullous pemphigoid3ClinicalTrials
Waldenstrom MacroglobulinemiaD008258EFO:0002616macroglobulinemia3ClinicalTrials
Diabetes Mellitus, Type 1D003922EFO:0001359type I diabetes mellitus2ClinicalTrials
Granulomatosis with PolyangiitisD014890EFO:0005297Wegener's granulomatosis4ClinicalTrials
DailyMed
LeukemiaD007938EFO:0000565leukemia3ClinicalTrials
Liver Cirrhosis, BiliaryD008105EFO:1001486primary biliary cirrhosis1ClinicalTrials
Lung Diseases, InterstitialD017563EFO:0004244interstitial lung disease3ClinicalTrials
Lung NeoplasmsD008175EFO:0001071lung carcinoma2ClinicalTrials
Lymphoma, AIDS-RelatedD016483EFO:1001365Lymphoma, AIDS-Related2ClinicalTrials
Lymphoma, FollicularD008224EFO:0000096neoplasm of mature B-cells3ClinicalTrials
Lymphoma, Non-HodgkinD008228EFO:0005952non-Hodgkins lymphoma3ClinicalTrials
Opsoclonus-Myoclonus SyndromeD053578EFO:1001383Opsoclonus-Myoclonus Syndrome1ClinicalTrials
Precursor Cell Lymphoblastic Leukemia-LymphomaD054198EFO:0000220acute lymphoblastic leukemia4ClinicalTrials
DailyMed
SarcoidosisD012507Orphanet:797Sarcoidosis2ClinicalTrials
Anemia, Sickle CellD000755Orphanet:232Sickle cell anemia2ClinicalTrials
Glomerulosclerosis, Focal SegmentalD005923EFO:0004236focal segmental glomerulosclerosis2ClinicalTrials
Lupus NephritisD008181EFO:0005761lupus nephritis3ClinicalTrials
Lymphoma, Large B-Cell, DiffuseD016403EFO:0000403diffuse large B-cell lymphoma3ClinicalTrials
Microscopic PolyangiitisD055953EFO:1000784microscopic polyangiitis4ClinicalTrials
DailyMed
Multiple Sclerosis, Relapsing-RemittingD020529EFO:0003929relapsing-remitting multiple sclerosis3ClinicalTrials
Nephrotic SyndromeD009404EFO:0004255nephrotic syndrome3ClinicalTrials
Neuromyelitis OpticaD009471EFO:0004256neuromyelitis optica2ClinicalTrials
ProteinuriaD011507HP:0000093Proteinuria3ClinicalTrials
Anti-Neutrophil Cytoplasmic Antibody-Associated VasculitisD056648EFO:0004826anti-neutrophil antibody associated vasculitis3ClinicalTrials
Crohn DiseaseD003424EFO:0000384Crohn's disease1ClinicalTrials
Leukemia, LymphoidD007945EFO:0004289lymphoid leukemia3ClinicalTrials
Lymphoproliferative DisordersD0082322ClinicalTrials
Multiple SclerosisD009103EFO:0003885multiple sclerosis3ClinicalTrials
Myelodysplastic SyndromesD009190EFO:0000198myelodysplastic syndrome1ClinicalTrials
NeoplasmsD009369EFO:0000311cancer4ClinicalTrials
Peripheral Nervous System DiseasesD010523EFO:0004149neuropathy3ClinicalTrials
Renal Insufficiency, ChronicD051436EFO:0003884chronic kidney disease1ClinicalTrials
Behcet SyndromeD001528EFO:0003780Behcet's syndrome2ClinicalTrials
Breast NeoplasmsD001943EFO:0003869breast neoplasm2ClinicalTrials
Diabetic NeuropathiesD003929EFO:1000783diabetic neuropathy2ClinicalTrials
Fatigue Syndrome, ChronicD015673EFO:0004540chronic fatigue syndrome3ClinicalTrials
Glycogen Storage Disease Type IID006009Orphanet:365Glycogen storage disease due to acid maltase deficiency1ClinicalTrials
Immunoblastic LymphadenopathyD007119EFO:0000255angioimmunoblastic T-cell lymphoma2ClinicalTrials
Lymphoma, B-Cell, Marginal ZoneD018442EFO:0000191MALT lymphoma3ClinicalTrials
Lymphoma, Mantle-CellD020522EFO:1001469Mantle cell lymphoma3ClinicalTrials
Multiple Sclerosis, Chronic ProgressiveD020528EFO:0003840chronic progressive multiple sclerosis2ClinicalTrials
NeoplasmsD009369EFO:0000616neoplasm4ATC
Scleroderma, SystemicD012595EFO:0000717systemic scleroderma2ClinicalTrials
Sjogren's SyndromeD012859EFO:0000699Sjogren syndrome2ClinicalTrials
Spondylitis, AnkylosingD013167EFO:0003898ankylosing spondylitis2ClinicalTrials
Stomach NeoplasmsD013274EFO:0003897stomach neoplasm2ClinicalTrials

Clinical Data

ClinicalTrials.gov RITUXIMAB
The Cochrane Collaboration RITUXIMAB

HELM Notation

CHEMBL1201576 HELM Notation
PEPTIDE1{Q.I.V.L.S.Q.S.P.A.I.L.S.A.S.P.G.E.K.V.T.M.T.C.R.A.S.S.S.V.S.Y.I.H.W.F.Q.Q.K.P.G.S.S.P.K.P.W.I.Y.A.T.S.N.L.A.S.G.V.P.V.R.F.S.G.S.G.S.G.T.S.Y.S.L.T.I.S.R.V.E.A.E.D.A.A.T.Y.Y.C.Q.Q.W.T.S.N.P.P.T.F.G.G.G.T.K.L.E.I.K.R.T.V.A.A.P.S.V.F.I.F.P.P.S.D.E.Q.L.K.S.G.T.A.S.V.V.C.L.L.N.N.F.Y.P.R.E.A.K.V.Q.W.K.V.D.N.A.L.Q.S.G.N.S.Q.E.S.V.T.E.Q.D.S.K.D.S.T.Y.S.L.S.S.T.L.T.L.S.K.A.D.Y.E.K.H.K.V.Y.A.C.E.V.T.H.Q.G.L.S.S.P.V.T.K.S.F.N.R.G.E.C}|PEPTIDE2{Q.V.Q.L.Q.Q.P.G.A.E.L.V.K.P.G.A.S.V.K.M.S.C.K.A.S.G.Y.T.F.T.S.Y.N.M.H.W.V.K.Q.T.P.G.R.G.L.E.W.I.G.A.I.Y.P.G.N.G.D.T.S.Y.N.Q.K.F.K.G.K.A.T.L.T.A.D.K.S.S.S.T.A.Y.M.Q.L.S.S.L.T.S.E.D.S.A.V.Y.Y.C.A.R.S.T.Y.Y.G.G.D.W.Y.F.N.V.W.G.A.G.T.T.V.T.V.S.A.A.S.T.K.G.P.S.V.F.P.L.A.P.S.S.K.S.T.S.G.G.T.A.A.L.G.C.L.V.K.D.Y.F.P.E.P.V.T.V.S.W.N.S.G.A.L.T.S.G.V.H.T.F.P.A.V.L.Q.S.S.G.L.Y.S.L.S.S.V.V.T.V.P.S.S.S.L.G.T.Q.T.Y.I.C.N.V.N.H.K.P.S.N.T.K.V.D.K.K.V.E.P.K.S.C.D.K.T.H.T.C.P.P.C.P.A.P.E.L.L.G.G.P.S.V.F.L.F.P.P.K.P.K.D.T.L.M.I.S.R.T.P.E.V.T.C.V.V.V.D.V.S.H.E.D.P.E.V.K.F.N.W.Y.V.D.G.V.E.V.H.N.A.K.T.K.P.R.E.E.Q.Y.N.S.T.Y.R.V.V.S.V.L.T.V.L.H.Q.D.W.L.N.G.K.E.Y.K.C.K.V.S.N.K.A.L.P.A.P.I.E.K.T.I.S.K.A.K.G.Q.P.R.E.P.Q.V.Y.T.L.P.P.S.R.D.E.L.T.K.N.Q.V.S.L.T.C.L.V.K.G.F.Y.P.S.D.I.A.V.E.W.E.S.N.G.Q.P.E.N.N.Y.K.T.T.P.P.V.L.D.S.D.G.S.F.F.L.Y.S.K.L.T.V.D.K.S.R.W.Q.Q.G.N.V.F.S.C.S.V.M.H.E.A.L.H.N.H.Y.T.Q.K.S.L.S.L.S.P.G.K}|PEPTIDE3{Q.V.Q.L.Q.Q.P.G.A.E.L.V.K.P.G.A.S.V.K.M.S.C.K.A.S.G.Y.T.F.T.S.Y.N.M.H.W.V.K.Q.T.P.G.R.G.L.E.W.I.G.A.I.Y.P.G.N.G.D.T.S.Y.N.Q.K.F.K.G.K.A.T.L.T.A.D.K.S.S.S.T.A.Y.M.Q.L.S.S.L.T.S.E.D.S.A.V.Y.Y.C.A.R.S.T.Y.Y.G.G.D.W.Y.F.N.V.W.G.A.G.T.T.V.T.V.S.A.A.S.T.K.G.P.S.V.F.P.L.A.P.S.S.K.S.T.S.G.G.T.A.A.L.G.C.L.V.K.D.Y.F.P.E.P.V.T.V.S.W.N.S.G.A.L.T.S.G.V.H.T.F.P.A.V.L.Q.S.S.G.L.Y.S.L.S.S.V.V.T.V.P.S.S.S.L.G.T.Q.T.Y.I.C.N.V.N.H.K.P.S.N.T.K.V.D.K.K.V.E.P.K.S.C.D.K.T.H.T.C.P.P.C.P.A.P.E.L.L.G.G.P.S.V.F.L.F.P.P.K.P.K.D.T.L.M.I.S.R.T.P.E.V.T.C.V.V.V.D.V.S.H.E.D.P.E.V.K.F.N.W.Y.V.D.G.V.E.V.H.N.A.K.T.K.P.R.E.E.Q.Y.N.S.T.Y.R.V.V.S.V.L.T.V.L.H.Q.D.W.L.N.G.K.E.Y.K.C.K.V.S.N.K.A.L.P.A.P.I.E.K.T.I.S.K.A.K.G.Q.P.R.E.P.Q.V.Y.T.L.P.P.S.R.D.E.L.T.K.N.Q.V.S.L.T.C.L.V.K.G.F.Y.P.S.D.I.A.V.E.W.E.S.N.G.Q.P.E.N.N.Y.K.T.T.P.P.V.L.D.S.D.G.S.F.F.L.Y.S.K.L.T.V.D.K.S.R.W.Q.Q.G.N.V.F.S.C.S.V.M.H.E.A.L.H.N.H.Y.T.Q.K.S.L.S.L.S.P.G.K}|PEPTIDE4{Q.I.V.L.S.Q.S.P.A.I.L.S.A.S.P.G.E.K.V.T.M.T.C.R.A.S.S.S.V.S.Y.I.H.W.F.Q.Q.K.P.G.S.S.P.K.P.W.I.Y.A.T.S.N.L.A.S.G.V.P.V.R.F.S.G.S.G.S.G.T.S.Y.S.L.T.I.S.R.V.E.A.E.D.A.A.T.Y.Y.C.Q.Q.W.T.S.N.P.P.T.F.G.G.G.T.K.L.E.I.K.R.T.V.A.A.P.S.V.F.I.F.P.P.S.D.E.Q.L.K.S.G.T.A.S.V.V.C.L.L.N.N.F.Y.P.R.E.A.K.V.Q.W.K.V.D.N.A.L.Q.S.G.N.S.Q.E.S.V.T.E.Q.D.S.K.D.S.T.Y.S.L.S.S.T.L.T.L.S.K.A.D.Y.E.K.H.K.V.Y.A.C.E.V.T.H.Q.G.L.S.S.P.V.T.K.S.F.N.R.G.E.C}$PEPTIDE2,PEPTIDE2,371:R3-429:R3|PEPTIDE1,PEPTIDE1,133:R3-193:R3|PEPTIDE2,PEPTIDE1,224:R3-213:R3|PEPTIDE3,PEPTIDE3,148:R3-204:R3|PEPTIDE3,PEPTIDE3,265:R3-325:R3|PEPTIDE4,PEPTIDE4,23:R3-87:R3|PEPTIDE3,PEPTIDE4,224:R3-213:R3|PEPTIDE2,PEPTIDE2,148:R3-204:R3|PEPTIDE3,PEPTIDE3,371:R3-429:R3|PEPTIDE2,PEPTIDE2,265:R3-325:R3|PEPTIDE1,PEPTIDE1,23:R3-87:R3|PEPTIDE2,PEPTIDE3,230:R3-230:R3|PEPTIDE2,PEPTIDE2,22:R3-96:R3|PEPTIDE2,PEPTIDE3,233:R3-233:R3|PEPTIDE4,PEPTIDE4,133:R3-193:R3|PEPTIDE3,PEPTIDE3,22:R3-96:R3$$$

The ChEMBL HELM monomer library is available to download here.

For more details about HELM Notation, please visit the HELM Homepage.

Biological Sequence

Description Sequence
Rituximab heavy chain QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAIYPGNGDTSY NQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTYYGGDWYFNVWGAGTTVTVS AASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLG GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Rituximab light chain QIVLSQSPAILSASPGEKVTMTCRASSSVSYIHWFQQKPGSSPKPWIYATSNLASGVPVR FSGSGSGTSYSLTISRVEAEDAATYYCQQWTSNPPTFGGGTKLEIKRTVAAPSVFIFPPS DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Compound Bioactivity Summary

Compound Assay Summary

Compound Target Summary

Compound Cross References

ATC L - ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS
L01 - ANTINEOPLASTIC AGENTS
L01X - OTHER ANTINEOPLASTIC AGENTS
L01XC - Monoclonal antibodies
L01XC02 - rituximab

ChemSpider ChemSpider Identifier not yet assigned
DailyMed rituximab
Wikipedia Rituximab
spacer
spacer