ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201565
CHEMBL1201565
Compound Name EPOETIN ALFA
ChEMBL Synonyms EPOETIN ALFA | PROCRIT | EPREX | EPO | BINOCRIT | EPOGEN
Max Phase 4 (Approved)
Trade Names EPREX | EPOGEN | PROCRIT | BINOCRIT

Sources

  • British National Formulary
  • Manually Added Drugs
  • Scientific Literature
  • USP Dictionary of USAN and International Drug Names

Molecule Features

CHEMBL1201565 compound icon
Drug Type:Oligopeptide Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:N Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Erythropoietin receptor agonist Erythropoietin receptor FDA

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
Friedreich AtaxiaD005621Orphanet:95Friedreich ataxia2ClinicalTrials
Pancreatic NeoplasmsD010190EFO:0002618pancreatic carcinoma2ClinicalTrials
Lung NeoplasmsD008175EFO:0001071lung carcinoma3ClinicalTrials
StrokeD020521EFO:0000712stroke2ClinicalTrials
Brain IschemiaD002545HP:0002637Cerebral ischemia3ClinicalTrials
Coronary Artery DiseaseD003324EFO:0000378coronary artery disease2ClinicalTrials
Leukemia, Myeloid, AcuteD015470EFO:0000222acute myeloid leukemia3ClinicalTrials
Myocardial InfarctionD009203EFO:0000612myocardial infarction2ClinicalTrials
Premature BirthD047928EFO:0003917premature birth2ClinicalTrials
Death, Sudden, CardiacD016757EFO:0004278sudden cardiac arrest3ClinicalTrials
HIV InfectionsD015658EFO:0000764HIV infection1ClinicalTrials
Prostatic NeoplasmsD011471EFO:0001663prostate carcinoma3ClinicalTrials
Hepatitis CD006526EFO:0003047hepatitis C infection3ClinicalTrials
Substance-Related DisordersD019966EFO:0003890drug dependence1ClinicalTrials
Wounds and InjuriesD014947EFO:0000546injury3ClinicalTrials
AnemiaD000740EFO:0004272anemia3ClinicalTrials
Breast NeoplasmsD001943EFO:0000305breast carcinoma3ClinicalTrials
Head and Neck NeoplasmsD006258EFO:0006859head and neck malignant neoplasia3ClinicalTrials
Renal Insufficiency, ChronicD051436EFO:0003884chronic kidney disease3ClinicalTrials
Peripheral Nervous System DiseasesD010523EFO:0003100peripheral neuropathy2ClinicalTrials
Venous ThrombosisD020246HP:0004936Venous thrombosis3ClinicalTrials
beta-ThalassemiaD017086Orphanet:848Beta-thalassemia2ClinicalTrials
Myelodysplastic SyndromesD009190EFO:0000198myelodysplastic syndrome3ClinicalTrials
NeoplasmsD009369EFO:0000311cancer2ClinicalTrials

Clinical Data

ClinicalTrials.gov EPOETIN ALFA
The Cochrane Collaboration EPOETIN ALFA

Biological Sequence

Description Sequence
Erythropoietin precursor MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHC SLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQL HVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKL KLYTGEACRTGDR

Compound Bioactivity Summary

Compound Assay Summary

Compound Target Summary

Compound Cross References

ChemSpider ChemSpider Identifier not yet assigned
Wikipedia Epoetin_alfa
spacer
spacer