ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201564
CHEMBL1201564
Compound Name INTERFERON GAMMA-1B
ChEMBL Synonyms INTERFERON GAMMA-1B | INTERFERON GAMMA | ACTIMMUNE | Interferon gama-1b | IMMUKIN | INTERFERON GAMMA-2A
Max Phase 4 (Approved)
Trade Names ACTIMMUNE | IMMUKIN

Sources

  • British National Formulary
  • Manually Added Drugs
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1201564 compound icon
Drug Type:Oligopeptide Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:N Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Interferon gamma receptor agonist Interferon gamma receptor FDA PubMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
Granulomatous Disease, ChronicD006105Orphanet:379Chronic granulomatous disease1ClinicalTrials
Prostatic NeoplasmsD011471EFO:0001663prostate carcinoma1ClinicalTrials
Arthritis, ReactiveD016918EFO:0007460reactive arthritis2ClinicalTrials
Lymphoma, Non-HodgkinD008228EFO:0005952non-Hodgkins lymphoma1ClinicalTrials
OsteopetrosisD010022Orphanet:53Albers-Sch??nberg osteopetrosis3ClinicalTrials
PsoriasisD011565EFO:0000676psoriasis0ClinicalTrials
Sezary SyndromeD012751EFO:1000785Sezary's disease2ClinicalTrials
UveitisD014605EFO:1001231uveitis1ClinicalTrials
Breast NeoplasmsD001943EFO:0000305breast carcinoma3ClinicalTrials
HIV InfectionsD015658EFO:0000764HIV infection2ClinicalTrials
Hepatitis C, ChronicD019698EFO:0004220Chronic Hepatitis C infection2ClinicalTrials
LeukemiaD007938EFO:0000565leukemia1ClinicalTrials
Multiple MyelomaD009101EFO:0001378multiple myeloma2ClinicalTrials
NeoplasmsD009369EFO:0000616neoplasm2ClinicalTrials
Idiopathic Pulmonary FibrosisD054990EFO:0000768idiopathic pulmonary fibrosis3ClinicalTrials
Meningitis, CryptococcalD016919EFO:0007228cryptococcal meningitis2ClinicalTrials
MesotheliomaD008654EFO:0000588mesothelioma2ClinicalTrials
OsteopetrosisD010022Orphanet:2781Osteopetrosis3ClinicalTrials
Bronchiolitis ObliteransD001989EFO:0007183bronchiolitis obliterans2ClinicalTrials
MelanomaD008545EFO:0000389cutaneous melanoma3ClinicalTrials
Ovarian NeoplasmsD010051Orphanet:398934Malignant epithelial tumor of ovary1ClinicalTrials
Colorectal NeoplasmsD015179EFO:1001951colorectal carcinoma2ClinicalTrials
Leukocyte-Adhesion Deficiency SyndromeD018370EFO:1001359Leukocyte-Adhesion Deficiency Syndrome2ClinicalTrials
Liver CirrhosisD008103EFO:0001422cirrhosis of liver2ClinicalTrials
Mycosis FungoidesD009182EFO:1001051mycosis fungoides2ClinicalTrials
Cystic FibrosisD003550Orphanet:586Cystic fibrosis1ClinicalTrials
Friedreich AtaxiaD005621Orphanet:95Friedreich ataxia3ClinicalTrials
Hepatitis B, ChronicD019694EFO:0004197hepatitis B infection2ClinicalTrials
LymphomaD008223EFO:0000574lymphoma2ClinicalTrials
MelanomaD008545EFO:0000756melanoma3ClinicalTrials
Mycobacterium avium-intracellulare InfectionD015270EFO:0007386Mycobacterium avium complex disease2ClinicalTrials

Clinical Data

ClinicalTrials.gov INTERFERON GAMMA-1B
The Cochrane Collaboration INTERFERON GAMMA-1B

Biological Sequence

Description Sequence
Interferon gamma precursor MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWK EESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTN YSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Compound Cross References

ATC L - ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS
L03 - IMMUNOSTIMULANTS
L03A - IMMUNOSTIMULANTS
L03AB - Interferons
L03AB03 - interferon gamma

ChemSpider ChemSpider Identifier not yet assigned
DailyMed interferon gamma-1b
Wikipedia Interferon-gamma
spacer
spacer