ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201562
CHEMBL1201562
Compound Name INTERFERON BETA-1A
ChEMBL Synonyms REBIF | NEOFERON | INTERFERON BETA-1A | AVONEX
Max Phase 4 (Approved)
Trade Names NEOFERON | AVONEX | REBIF

Sources

  • Manually Added Drugs
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1201562 compound icon
Drug Type:Oligopeptide Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:N Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Interferon alpha/beta receptor agonist Interferon alpha/beta receptor FDA PubMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
Polyradiculoneuropathy, Chronic Inflammatory DemyelinatingD020277EFO:1000868chronic inflammatory demyelinating polyradiculoneuropathy2ClinicalTrials
Alzheimer DiseaseD000544EFO:0000249Alzheimers disease2ClinicalTrials
Crohn DiseaseD003424EFO:0000384Crohn's disease2ClinicalTrials
Respiratory Distress Syndrome, AdultD012128EFO:1000637acute respiratory distress syndrome3ClinicalTrials
Multiple Sclerosis, Relapsing-RemittingD020529EFO:0003929relapsing-remitting multiple sclerosis3ClinicalTrials
Multiple SclerosisD009103EFO:0003885multiple sclerosis3ClinicalTrials
Colitis, UlcerativeD003093EFO:0000729ulcerative colitis2ClinicalTrials
Hepatitis CD006526EFO:0003047hepatitis C infection3ClinicalTrials
Multiple Organ FailureD009102EFO:1001373Multiple Organ Failure2ClinicalTrials
AsthmaD001249EFO:0000270asthma2ClinicalTrials
StrokeD020521EFO:0000712stroke1ClinicalTrials

Clinical Data

ClinicalTrials.gov INTERFERON BETA-1A
The Cochrane Collaboration INTERFERON BETA-1A

Biological Sequence

Description Sequence
Interferon beta precursor MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFD IPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLK TVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINR LTGYLRN

Compound Cross References

ATC L - ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS
L03 - IMMUNOSTIMULANTS
L03A - IMMUNOSTIMULANTS
L03AB - Interferons
L03AB07 - interferon beta-1a

ChemSpider ChemSpider Identifier not yet assigned
DailyMed interferon beta-1a
Wikipedia Interferon_beta-1a
spacer
spacer