ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201562
CHEMBL1201562
Compound Name INTERFERON BETA-1A
ChEMBL Synonyms Avonex | NEOFERON | Rebif | INTERFERON BETA-1A
Max Phase 4 (Approved)
Trade Names NEOFERON | Rebif | Avonex

Sources

  • Manually Added Drugs
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1201562 compound icon
Drug Type:Oligopeptide Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:N Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Interferon alpha/beta receptor agonist Interferon alpha/beta receptor DailyMed FDA PubMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
MULTIPLE SCLEROSISD009103EFO:0003885MULTIPLE SCLEROSIS4ClinicalTrials
HEPATITIS CD006526EFO:0003047HEPATITIS C INFECTION3ClinicalTrials
MULTIPLE SCLEROSIS, RELAPSING-REMITTINGD020529EFO:0003929RELAPSING-REMITTING MULTIPLE SCLEROSIS3ClinicalTrials
ALZHEIMER DISEASED000544EFO:0000249ALZHEIMERS DISEASE2ClinicalTrials
ASTHMAD001249EFO:0000270ASTHMA2ClinicalTrials
COLITIS, ULCERATIVED003093EFO:0000729ULCERATIVE COLITIS2ClinicalTrials
RESPIRATORY DISTRESS SYNDROME, ADULTD012128EFO:1000637ACUTE RESPIRATORY DISTRESS SYNDROME3ClinicalTrials

Clinical Data

ClinicalTrials.gov INTERFERON BETA-1A
The Cochrane Collaboration INTERFERON BETA-1A

Biological Sequence

Description Sequence
Interferon beta precursor MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFD IPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLK TVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINR LTGYLRN

Compound Cross References

ATC L - ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS
L03 - IMMUNOSTIMULANTS
L03A - IMMUNOSTIMULANTS
L03AB - Interferons
L03AB07 - interferon beta-1a

ChemSpider ChemSpider Identifier not yet assigned
DailyMed interferon beta-1a
Wikipedia Interferon_beta-1a
spacer
spacer