ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201550
CHEMBL1201550
Compound Name DENILEUKIN DIFTITOX
ChEMBL Synonyms DAB389 IL2 | DENILEUKIN DIFTITOX | Ontak
Max Phase 4 (Approved)
Trade Names Ontak

Sources

  • Manually Added Drugs
  • Scientific Literature
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1201550 compound icon
Drug Type:Oligopeptide Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:Y Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Elongation factor 2 inhibitor Elongation factor 2 DailyMed FDA PubMed
Interleukin-2 receptor binding agent Interleukin-2 receptor DailyMed FDA PubMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
LYMPHOMA, T-CELL, PERIPHERALD016411EFO:0000211UNSPECIFIED PERIPHERAL T-CELL LYMPHOMA1ClinicalTrials
NEOPLASMSD009369EFO:0000616NEOPLASM4ATC
LEUKEMIA, BIPHENOTYPIC, ACUTED015456EFO:0000209T-CELL ACUTE LYMPHOBLASTIC LEUKEMIA2ClinicalTrials
BREAST NEOPLASMS, MALED018567EFO:0006861MALE BREAST CARCINOMA1ClinicalTrials
GRAFT VS HOST DISEASED006086EFO:0004599ACUTE GRAFT VS. HOST DISEASE2ClinicalTrials
LYMPHOMAD008223EFO:0000574LYMPHOMA2ClinicalTrials
MULTIPLE MYELOMAD009101EFO:0001378MULTIPLE MYELOMA1ClinicalTrials
OVARIAN NEOPLASMSD010051EFO:0001075OVARIAN CARCINOMA2ClinicalTrials
MELANOMAD008545EFO:0000756MELANOMA2ClinicalTrials
PANCREATIC NEOPLASMSD010190EFO:0002618PANCREATIC CARCINOMA2ClinicalTrials

Clinical Data

ClinicalTrials.gov DENILEUKIN DIFTITOX
The Cochrane Collaboration DENILEUKIN DIFTITOX

Biological Sequence

Description Sequence
Diphtheria toxin precursor MLVRGYVVSRKLFASILIGALLGIGAPPSAHAGADDVVDSSKSFVMENFSSYHGTKPGYV DSIQKGIQKPKSGTQGNYDDDWKGFYSTDNKYDAAGYSVDNENPLSGKAGGVVKVTYPGL TKVLALKVDNAETIKKELGLSLTEPLMEQVGTEEFIKRFGDGASRVVLSLPFAEGSSSVE YINNWEQAKALSVELEINFETRGKRGQDAMYEYMAQACAGNRVRRSVGSSLSCINLDWDV IRDKTKTKIESLKEHGPIKNKMSESPNKTVSEEKAKQYLEEFHQTALEHPELSELKTVTG TNPVFAGANYAAWAVNVAQVIDSETADNLEKTTAALSILPGIGSVMGIADGAVHHNTEEI VAQSIALSSLMVAQAIPLVGELVDIGFAAYNFVESIINLFQVVHNSYNRPAYSPGHKTQP FLHDGYAVSWNTVEDSIIRTGFQGESGHDIKITAENTPLPIAGVLLPTIPGKLDVNKSKT HISVNGRKIRMRCRAIDGDVTFCRPKSPVYVGNGVHANLHVAFHRSSSEKIHSNEISSDS IGVLGYQKTVDHTKVNSKLSLFFEIKS

Compound Bioactivity Summary

Compound Assay Summary

Compound Target Summary

Compound Cross References

ATC L - ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS
L01 - ANTINEOPLASTIC AGENTS
L01X - OTHER ANTINEOPLASTIC AGENTS
L01XX - Other antineoplastic agents
L01XX29 - denileukin diftitox

ChemSpider ChemSpider Identifier not yet assigned
DailyMed denileukin diftitox
Wikipedia Denileukin_diftitox Resimmune
spacer
spacer