ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201496
CHEMBL1201496
Compound Name INSULIN ASPART
ChEMBL Synonyms INA-X14 | INS NOVORAPID | INSULIN X14 | INSULIN ASPART | NOVOLOG | INSULIN ASPART RECOMBINANT | NOVOLOG INNOLET | NOVOLOG PENFILL | NOVOLOG FLEXTOUCH | FIASP FLEXTOUCH | FIASP | NOVOLOG FLEXPEN | B28-ASP-INSULIN
Max Phase 4 (Approved)
Trade Names NOVOLOG INNOLET | NOVOLOG PENFILL | INS NOVORAPID | NOVOLOG | NOVOLOG FLEXPEN | FIASP | FIASP FLEXTOUCH | NOVOLOG FLEXTOUCH

Sources

  • British National Formulary
  • Orange Book
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1201496 compound icon
Drug Type:Oligopeptide Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:N Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Insulin receptor agonist Insulin receptor DailyMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
Cystic FibrosisD003550Orphanet:586Cystic fibrosis2ClinicalTrials
Diabetes Mellitus, Type 1D003922EFO:0001359type I diabetes mellitus3ClinicalTrials
Diabetes Mellitus, Type 2D003924EFO:0001360type II diabetes mellitus3ClinicalTrials
Diabetes, GestationalD016640EFO:0004593gestational diabetes3ClinicalTrials
LymphomaD008223EFO:0000574lymphoma3ClinicalTrials
Alzheimer DiseaseD000544EFO:0000249Alzheimers disease1ClinicalTrials
Diabetes MellitusD003920EFO:0000400diabetes mellitus4ATC
ATC
ClinicalTrials
LeukemiaD007938EFO:0000565leukemia3ClinicalTrials

Clinical Data

ClinicalTrials.gov INSULIN ASPART
The Cochrane Collaboration INSULIN ASPART

Biological Sequence

Description Sequence
Purified semisynthetic human insulin zinc suspension MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED LQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN

Compound Cross References

ATC A - ALIMENTARY TRACT AND METABOLISM
A10 - DRUGS USED IN DIABETES
A10A - INSULINS AND ANALOGUES
A10AD - Insulins and analogues for injection, intermediate- or long-acting combined with fast-acting
A10AD05 - insulin aspart

A - ALIMENTARY TRACT AND METABOLISM
A10 - DRUGS USED IN DIABETES
A10A - INSULINS AND ANALOGUES
A10AB - Insulins and analogues for injection, fast-acting
A10AB05 - insulin aspart

ChemSpider ChemSpider Identifier not yet assigned
DailyMed insulin aspart insulin aspart recombinant
Wikipedia Insulin_aspart
spacer
spacer