ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL3137343
CHEMBL3137343
Compound Name PEMBROLIZUMAB
ChEMBL Synonyms LAMBROLIZUMAB | PEMBROLIZUMAB | KEYTRUDA
Max Phase 4 (Approved)
Trade Names KEYTRUDA

Sources

  • British National Formulary
  • Manually Added Drugs
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL3137343 compound icon
Drug Type:Antibody Rule of Five:N First In Class:Y Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:N Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Programmed cell death protein 1 inhibitor Programmed cell death protein 1 FDA

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
Anus NeoplasmsD001005EFO:0003835anal neoplasm2ClinicalTrials
Breast NeoplasmsD001943EFO:0003869breast neoplasm3ClinicalTrials
Carcinoma, Non-Small-Cell LungD002289EFO:0003060non-small cell lung carcinoma3ClinicalTrials
Carcinoma, Squamous CellD002294EFO:0000181head and neck squamous cell carcinoma3ClinicalTrials
Gastrointestinal Stromal TumorsD046152Orphanet:44890Gastrointestinal stromal tumor2ClinicalTrials
GlioblastomaD005909EFO:0000519glioblastoma multiforme2ClinicalTrials
Leukemia, Biphenotypic, AcuteD015456EFO:0000094B-cell acute lymphoblastic leukemia1ClinicalTrials
Lymphoma, FollicularD008224EFO:0000096neoplasm of mature B-cells2ClinicalTrials
MelanomaD008545EFO:0000389cutaneous melanoma4ClinicalTrials
MeningiomaD008579Orphanet:2495Meningioma2ClinicalTrials
NeoplasmsD009369EFO:0000311cancer4ClinicalTrials
Rectal NeoplasmsD012004EFO:1000657rectum cancer2ClinicalTrials
Urinary Bladder NeoplasmsD001749EFO:0000292bladder carcinoma2ClinicalTrials
Endometrial NeoplasmsD016889EFO:0004230endometrial neoplasm2ClinicalTrials
Myelodysplastic SyndromesD009190EFO:0000198myelodysplastic syndrome2ClinicalTrials
NeoplasmsD009369EFO:0000616neoplasm4ATC
ClinicalTrials
NeuroblastomaD009447EFO:0000621neuroblastoma1ClinicalTrials
Prostatic NeoplasmsD011471EFO:0000196metastatic prostate cancer2ClinicalTrials
Sarcoma, Alveolar Soft PartD018234EFO:0007143alveolar soft part sarcoma2ClinicalTrials
Small Cell Lung CarcinomaD055752EFO:0000702small cell lung carcinoma3ClinicalTrials
Biliary Tract NeoplasmsD001661EFO:0003891biliary tract neoplasm2ClinicalTrials
Colonic NeoplasmsD003110EFO:1001950colon carcinoma1ClinicalTrials
Esophageal NeoplasmsD004938EFO:0005922esophageal squamous cell carcinoma3ClinicalTrials
Head and Neck NeoplasmsD006258EFO:0004284upper aerodigestive tract neoplasm3ClinicalTrials
Head and Neck NeoplasmsD006258EFO:0006859head and neck malignant neoplasia3ClinicalTrials
Mouth NeoplasmsD009062EFO:0003868mouth neoplasm2ClinicalTrials
Nasopharyngeal NeoplasmsD009303EFO:0004252nasopharyngeal neoplasm3ClinicalTrials
OsteosarcomaD012516EFO:0000637osteosarcoma2ClinicalTrials
Ovarian NeoplasmsD010051EFO:0001075ovarian carcinoma2ClinicalTrials
Ovarian NeoplasmsD010051EFO:0003893ovarian neoplasm2ClinicalTrials
Uterine Cervical NeoplasmsD002583EFO:0001061cervical carcinoma2ClinicalTrials
Carcinoma, Renal CellD002292EFO:0000681renal cell carcinoma3ClinicalTrials
CholangiocarcinomaD018281EFO:0005221cholangiocarcinoma2ClinicalTrials
Endometrial NeoplasmsD016889EFO:1001512endometrial carcinoma2ClinicalTrials
Lymphoma, Large B-Cell, DiffuseD016403EFO:0000403diffuse large B-cell lymphoma2ClinicalTrials
Meningeal NeoplasmsD008577EFO:0003851meningeal neoplasm2ClinicalTrials
NeurilemmomaD009442EFO:0000760malignant peripheral nerve sheath tumor2ClinicalTrials
Neuroendocrine TumorsD018358EFO:1001901neuroendocrine neoplasm2ClinicalTrials
Sezary SyndromeD012751EFO:1000785Sezary's disease2ClinicalTrials
Carcinoma, Merkel CellD015266EFO:1001471Merkel cell skin cancer2ClinicalTrials
Carcinoma, Squamous CellD002294EFO:0000707squamous cell carcinoma3ClinicalTrials
GliosarcomaD018316EFO:1001465gliosarcoma2ClinicalTrials
Hodgkin DiseaseD006689EFO:0000183Hodgkins lymphoma3ClinicalTrials
LymphomaD008223EFO:0000574lymphoma2ClinicalTrials
MelanomaD008545EFO:0002617metastatic melanoma4ClinicalTrials
DailyMed
Mycosis FungoidesD009182EFO:1001051mycosis fungoides2ClinicalTrials
Prostatic NeoplasmsD011471EFO:0001663prostate carcinoma2ClinicalTrials
SarcomaD012509EFO:0000691sarcoma2ClinicalTrials
Stomach NeoplasmsD013274EFO:0000178gastric carcinoma3ClinicalTrials
Adenocarcinoma, FollicularD018263EFO:0000501follicular thyroid carcinoma2ClinicalTrials
Breast NeoplasmsD001943EFO:0000305breast carcinoma3ClinicalTrials
Breast Neoplasms, MaleD018567EFO:0006861male breast carcinoma2ClinicalTrials
Carcinoma, Basal CellD002280EFO:0004193basal cell carcinoma2ClinicalTrials
Carcinoma, Renal CellD002292EFO:0000349clear cell renal carcinoma3ClinicalTrials
Colorectal NeoplasmsD015179EFO:1001951colorectal carcinoma3ClinicalTrials
Lung NeoplasmsD008175EFO:0001071lung carcinoma1ClinicalTrials
Lymphoma, T-Cell, CutaneousD016410EFO:0002913Cutaneous T-cell lymphoma2ClinicalTrials
Multiple MyelomaD009101EFO:0001378multiple myeloma3ClinicalTrials
Stomach NeoplasmsD013274EFO:0000503gastric adenocarcinoma3ClinicalTrials
ThymomaD013945EFO:1000581Thymoma2ClinicalTrials
Thyroid NeoplasmsD013964EFO:0000641papillary thyroid carcinoma2ClinicalTrials
Thyroid NeoplasmsD013964EFO:0002892thyroid carcinoma2ClinicalTrials
Urogenital NeoplasmsD014565EFO:0003863urogenital neoplasm3ClinicalTrials
Adrenocortical CarcinomaD018268EFO:0003093adrenocortical carcinoma2ClinicalTrials
CarcinomaD002277EFO:0000313carcinoma3ClinicalTrials
Carcinoma, Renal CellD002292EFO:0002890renal carcinoma3ClinicalTrials
GliomaD005910EFO:0000326central nervous system cancer1ClinicalTrials
Leukemia, Lymphocytic, Chronic, B-CellD015451EFO:0000095chronic lymphocytic leukemia2ClinicalTrials
Pancreatic NeoplasmsD010190EFO:0002618pancreatic carcinoma2ClinicalTrials
SarcomaD012509EFO:1001968soft tissue sarcoma2ClinicalTrials
Carcinoma, Adenoid CysticD003528EFO:0000231adenoid cystic carcinoma2ClinicalTrials
Carcinoma, DuctalD044584EFO:0000430ductal adenocarcinoma0ClinicalTrials
Carcinoma, HepatocellularD006528EFO:0000182hepatocellular carcinoma3ClinicalTrials
Esophageal NeoplasmsD004938EFO:0002916esophageal carcinoma3ClinicalTrials
HIV InfectionsD015658EFO:0000764HIV infection1ClinicalTrials
Inflammatory Breast NeoplasmsD058922EFO:1000984inflammatory breast carcinoma2ClinicalTrials
Leukemia, Myeloid, AcuteD015470EFO:0000222acute myeloid leukemia2ClinicalTrials
Lymphoma, Non-HodgkinD008228EFO:0005952non-Hodgkins lymphoma2ClinicalTrials
MelanomaD008545EFO:0000756melanoma4ClinicalTrials
MesotheliomaD008654EFO:0000588mesothelioma3ClinicalTrials
MesotheliomaD008654EFO:0000770malignant pleural mesothelioma3ClinicalTrials
Prostatic NeoplasmsD011471EFO:0000673prostate adenocarcinoma2ClinicalTrials
ThymomaD013945EFO:1000576Thymic Carcinoma2ClinicalTrials

Clinical Data

ClinicalTrials.gov PEMBROLIZUMAB
The Cochrane Collaboration PEMBROLIZUMAB

Biological Sequence

Description Sequence
Pembrolizumab heavy chain QVQLVQSGVEVKKPGASVKVSCKASGYTFTNYYMYWVRQAPGQGLEWMGGINPSNGGTNF NEKFKNRVTLTTDSSTTTAYMELKSLQFDDTAVYYCARRDYRFDMGFDYWGQGTTVTVSS ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTY RVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTK NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEG NVFSCSVMHEALHNHYTQKSLSLSLGK
Pembrolizumab light chain EIVLTQSPATLSLSPGERATLSCRASKGVSTSGYSYLHWYQQKPGQAPRLLIYLASYLES GVPARFSGSGSGTDFTLTISSLEPEDFAVYYCQHSRDLPLTFGGGTKVEIKRTVAAPSVF IFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Compound Cross References

ATC L - ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS
L01 - ANTINEOPLASTIC AGENTS
L01X - OTHER ANTINEOPLASTIC AGENTS
L01XC - Monoclonal antibodies
L01XC18 - pembrolizumab

ChemSpider ChemSpider Identifier not yet assigned
DailyMed pembrolizumab
spacer
spacer