ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL2109540
CHEMBL2109540
Compound Name ALIROCUMAB
ChEMBL Synonyms PRALUENT | REGN727 | SAR236553 | ALIROCUMAB
Max Phase 4 (Approved)
Trade Names PRALUENT

Sources

  • British National Formulary
  • Clinical Candidates
  • Manually Added Drugs
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL2109540 compound icon
Drug Type:Antibody Rule of Five:N First In Class:Y Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:N Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Subtilisin/kexin type 9 inhibitor Subtilisin/kexin type 9 DailyMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
Lipid Metabolism DisordersD052439Orphanet:309005Disorder of lipid metabolism3ClinicalTrials
AtherosclerosisD050197EFO:0003914atherosclerosis3ClinicalTrials
Diabetes MellitusD003920EFO:0000400diabetes mellitus3ClinicalTrials
Acute Coronary SyndromeD054058EFO:0005672acute coronary syndrome3ClinicalTrials
Hyperlipoproteinemia Type IID006938Orphanet:391665Homozygous familial hypercholesterolemia4ClinicalTrials
Coronary Artery DiseaseD003324EFO:0000378coronary artery disease4DailyMed
HypercholesterolemiaD006937HP:0003124hypercholesterolemia3ClinicalTrials
Hyperlipoproteinemia Type IID006938EFO:0004911familial hypercholesterolemia4ClinicalTrials
DailyMed
Cardiovascular DiseasesD002318EFO:0000319cardiovascular disease4ATC

Clinical Data

ClinicalTrials.gov ALIROCUMAB
The Cochrane Collaboration ALIROCUMAB

HELM Notation

CHEMBL2109540 HELM Notation
PEPTIDE1{D.I.V.M.T.Q.S.P.D.S.L.A.V.S.L.G.E.R.A.T.I.N.C.K.S.S.Q.S.V.L.Y.R.S.N.N.R.N.F.L.G.W.Y.Q.Q.K.P.G.Q.P.P.N.L.L.I.Y.W.A.S.T.R.E.S.G.V.P.D.R.F.S.G.S.G.S.G.T.D.F.T.L.T.I.S.S.L.Q.A.E.D.V.A.V.Y.Y.C.Q.Q.Y.Y.T.T.P.Y.T.F.G.Q.G.T.K.L.E.I.K.R.T.V.A.A.P.S.V.F.I.F.P.P.S.D.E.Q.L.K.S.G.T.A.S.V.V.C.L.L.N.N.F.Y.P.R.E.A.K.V.Q.W.K.V.D.N.A.L.Q.S.G.N.S.Q.E.S.V.T.E.Q.D.S.K.D.S.T.Y.S.L.S.S.T.L.T.L.S.K.A.D.Y.E.K.H.K.V.Y.A.C.E.V.T.H.Q.G.L.S.S.P.V.T.K.S.F.N.R.G.E.C}|PEPTIDE2{E.V.Q.L.V.E.S.G.G.G.L.V.Q.P.G.G.S.L.R.L.S.C.A.A.S.G.F.T.F.N.N.Y.A.M.N.W.V.R.Q.A.P.G.K.G.L.D.W.V.S.T.I.S.G.S.G.G.T.T.N.Y.A.D.S.V.K.G.R.F.I.I.S.R.D.S.S.K.H.T.L.Y.L.Q.M.N.S.L.R.A.E.D.T.A.V.Y.Y.C.A.K.D.S.N.W.G.N.F.D.L.W.G.R.G.T.L.V.T.V.S.S.A.S.T.K.G.P.S.V.F.P.L.A.P.S.S.K.S.T.S.G.G.T.A.A.L.G.C.L.V.K.D.Y.F.P.E.P.V.T.V.S.W.N.S.G.A.L.T.S.G.V.H.T.F.P.A.V.L.Q.S.S.G.L.Y.S.L.S.S.V.V.T.V.P.S.S.S.L.G.T.Q.T.Y.I.C.N.V.N.H.K.P.S.N.T.K.V.D.K.K.V.E.P.K.S.C.D.K.T.H.T.C.P.P.C.P.A.P.E.L.L.G.G.P.S.V.F.L.F.P.P.K.P.K.D.T.L.M.I.S.R.T.P.E.V.T.C.V.V.V.D.V.S.H.E.D.P.E.V.K.F.N.W.Y.V.D.G.V.E.V.H.N.A.K.T.K.P.R.E.E.Q.Y.N.S.T.Y.R.V.V.S.V.L.T.V.L.H.Q.D.W.L.N.G.K.E.Y.K.C.K.V.S.N.K.A.L.P.A.P.I.E.K.T.I.S.K.A.K.G.Q.P.R.E.P.Q.V.Y.T.L.P.P.S.R.D.E.L.T.K.N.Q.V.S.L.T.C.L.V.K.G.F.Y.P.S.D.I.A.V.E.W.E.S.N.G.Q.P.E.N.N.Y.K.T.T.P.P.V.L.D.S.D.G.S.F.F.L.Y.S.K.L.T.V.D.K.S.R.W.Q.Q.G.N.V.F.S.C.S.V.M.H.E.A.L.H.N.H.Y.T.Q.K.S.L.S.L.S.P.G}|PEPTIDE3{E.V.Q.L.V.E.S.G.G.G.L.V.Q.P.G.G.S.L.R.L.S.C.A.A.S.G.F.T.F.N.N.Y.A.M.N.W.V.R.Q.A.P.G.K.G.L.D.W.V.S.T.I.S.G.S.G.G.T.T.N.Y.A.D.S.V.K.G.R.F.I.I.S.R.D.S.S.K.H.T.L.Y.L.Q.M.N.S.L.R.A.E.D.T.A.V.Y.Y.C.A.K.D.S.N.W.G.N.F.D.L.W.G.R.G.T.L.V.T.V.S.S.A.S.T.K.G.P.S.V.F.P.L.A.P.S.S.K.S.T.S.G.G.T.A.A.L.G.C.L.V.K.D.Y.F.P.E.P.V.T.V.S.W.N.S.G.A.L.T.S.G.V.H.T.F.P.A.V.L.Q.S.S.G.L.Y.S.L.S.S.V.V.T.V.P.S.S.S.L.G.T.Q.T.Y.I.C.N.V.N.H.K.P.S.N.T.K.V.D.K.K.V.E.P.K.S.C.D.K.T.H.T.C.P.P.C.P.A.P.E.L.L.G.G.P.S.V.F.L.F.P.P.K.P.K.D.T.L.M.I.S.R.T.P.E.V.T.C.V.V.V.D.V.S.H.E.D.P.E.V.K.F.N.W.Y.V.D.G.V.E.V.H.N.A.K.T.K.P.R.E.E.Q.Y.N.S.T.Y.R.V.V.S.V.L.T.V.L.H.Q.D.W.L.N.G.K.E.Y.K.C.K.V.S.N.K.A.L.P.A.P.I.E.K.T.I.S.K.A.K.G.Q.P.R.E.P.Q.V.Y.T.L.P.P.S.R.D.E.L.T.K.N.Q.V.S.L.T.C.L.V.K.G.F.Y.P.S.D.I.A.V.E.W.E.S.N.G.Q.P.E.N.N.Y.K.T.T.P.P.V.L.D.S.D.G.S.F.F.L.Y.S.K.L.T.V.D.K.S.R.W.Q.Q.G.N.V.F.S.C.S.V.M.H.E.A.L.H.N.H.Y.T.Q.K.S.L.S.L.S.P.G}|PEPTIDE4{D.I.V.M.T.Q.S.P.D.S.L.A.V.S.L.G.E.R.A.T.I.N.C.K.S.S.Q.S.V.L.Y.R.S.N.N.R.N.F.L.G.W.Y.Q.Q.K.P.G.Q.P.P.N.L.L.I.Y.W.A.S.T.R.E.S.G.V.P.D.R.F.S.G.S.G.S.G.T.D.F.T.L.T.I.S.S.L.Q.A.E.D.V.A.V.Y.Y.C.Q.Q.Y.Y.T.T.P.Y.T.F.G.Q.G.T.K.L.E.I.K.R.T.V.A.A.P.S.V.F.I.F.P.P.S.D.E.Q.L.K.S.G.T.A.S.V.V.C.L.L.N.N.F.Y.P.R.E.A.K.V.Q.W.K.V.D.N.A.L.Q.S.G.N.S.Q.E.S.V.T.E.Q.D.S.K.D.S.T.Y.S.L.S.S.T.L.T.L.S.K.A.D.Y.E.K.H.K.V.Y.A.C.E.V.T.H.Q.G.L.S.S.P.V.T.K.S.F.N.R.G.E.C}$PEPTIDE1,PEPTIDE1,140:R3-200:R3|PEPTIDE3,PEPTIDE3,22:R3-96:R3|PEPTIDE3,PEPTIDE3,262:R3-322:R3|PEPTIDE2,PEPTIDE2,22:R3-96:R3|PEPTIDE3,PEPTIDE4,221:R3-220:R3|PEPTIDE2,PEPTIDE2,368:R3-426:R3|PEPTIDE3,PEPTIDE3,145:R3-201:R3|PEPTIDE3,PEPTIDE3,368:R3-426:R3|PEPTIDE1,PEPTIDE1,23:R3-94:R3|PEPTIDE4,PEPTIDE4,23:R3-94:R3|PEPTIDE2,PEPTIDE2,145:R3-201:R3|PEPTIDE2,PEPTIDE3,227:R3-227:R3|PEPTIDE4,PEPTIDE4,140:R3-200:R3|PEPTIDE2,PEPTIDE1,221:R3-220:R3|PEPTIDE2,PEPTIDE2,262:R3-322:R3|PEPTIDE2,PEPTIDE3,230:R3-230:R3$$$

The ChEMBL HELM monomer library is available to download here.

For more details about HELM Notation, please visit the HELM Homepage.

Biological Sequence

Description Sequence
Alirocumab heavy chain EVQLVESGGGLVQPGGSLRLSCAASGFTFNNYAMNWVRQAPGKGLDWVSTISGSGGTTNY ADSVKGRFIISRDSSKHTLYLQMNSLRAEDTAVYYCAKDSNWGNFDLWGRGTLVTVSSAS TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPS VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSPG
Alirocumab light chain DIVMTQSPDSLAVSLGERATINCKSSQSVLYRSNNRNFLGWYQQKPGQPPNLLIYWASTR ESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYTTPYTFGQGTKLEIKRTVAAPS VFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYS LSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Compound Cross References

ATC C - CARDIOVASCULAR SYSTEM
C10 - LIPID MODIFYING AGENTS
C10A - LIPID MODIFYING AGENTS, PLAIN
C10AX - Other lipid modifying agents
C10AX14 - alirocumab

ChemSpider ChemSpider Identifier not yet assigned
DailyMed alirocumab
spacer
spacer