ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL2109385
CHEMBL2109385
Compound Name ENOTICUMAB
ChEMBL Synonyms Enoticumab | REGN-421
Max Phase 0
Trade Names

Sources

  • Clinical Candidates

Molecule Features

CHEMBL2109385 compound icon
Drug Type:Antibody Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:Unclassified Parenteral:Unclassified Topical:Unclassified Black Box:Unclassified Availability Type:Unclassified

Mechanism of Action

Mechanism of Action ChEMBL Target References
Delta-like protein 4 inhibitor Delta-like protein 4 PubMed

Clinical Data

ClinicalTrials.gov ENOTICUMAB
The Cochrane Collaboration ENOTICUMAB

HELM Notation

CHEMBL2109385 HELM Notation
PEPTIDE1{E.I.V.L.T.Q.S.P.A.T.L.S.L.S.P.G.E.R.A.T.L.S.C.R.A.S.Q.S.V.S.S.Y.L.A.W.Y.Q.Q.K.P.G.Q.A.P.R.L.L.I.Y.D.A.S.N.R.A.T.G.I.P.A.R.F.S.G.S.G.S.G.T.D.F.T.L.T.I.S.S.L.E.P.E.D.F.A.V.Y.Y.C.Q.H.R.S.N.W.P.P.T.F.G.G.G.T.K.V.E.I.K.R.T.V.A.A.P.S.V.F.I.F.P.P.S.D.E.Q.L.K.S.G.T.A.S.V.V.C.L.L.N.N.F.Y.P.R.E.A.K.V.Q.W.K.V.D.N.A.L.Q.S.G.N.S.Q.E.S.V.T.E.Q.D.S.K.D.S.T.Y.S.L.S.S.T.L.T.L.S.K.A.D.Y.E.K.H.K.V.Y.A.C.E.V.T.H.Q.G.L.S.S.P.V.T.K.S.F.N.R.G.E.C}|PEPTIDE2{Q.V.Q.L.V.E.S.G.G.G.V.V.Q.P.G.R.S.L.R.L.S.C.A.A.S.G.F.T.F.S.S.Y.G.M.H.W.V.R.Q.A.P.G.K.G.L.E.W.V.S.F.L.W.Y.D.G.T.N.K.N.Y.V.E.S.V.K.G.R.F.T.I.S.R.D.N.S.K.N.M.L.Y.L.E.M.N.S.L.R.A.E.D.T.A.V.Y.Y.C.A.R.D.H.D.F.R.S.G.Y.E.G.W.F.D.P.W.G.Q.G.T.L.V.T.V.S.S.A.S.T.K.G.P.S.V.F.P.L.A.P.S.S.K.S.T.S.G.G.T.A.A.L.G.C.L.V.K.D.Y.F.P.E.P.V.T.V.S.W.N.S.G.A.L.T.S.G.V.H.T.F.P.A.V.L.Q.S.S.G.L.Y.S.L.S.S.V.V.T.V.P.S.S.S.L.G.T.Q.T.Y.I.C.N.V.N.H.K.P.S.N.T.K.V.D.K.K.V.E.P.K.S.C.D.K.T.H.T.C.P.P.C.P.A.P.E.L.L.G.G.P.S.V.F.L.F.P.P.K.P.K.D.T.L.M.I.S.R.T.P.E.V.T.C.V.V.V.D.V.S.H.E.D.P.E.V.K.F.N.W.Y.V.D.G.V.E.V.H.N.A.K.T.K.P.R.E.E.Q.Y.N.S.T.Y.R.V.V.S.V.L.T.V.L.H.Q.D.W.L.N.G.K.E.Y.K.C.K.V.S.N.K.A.L.P.A.P.I.E.K.T.I.S.K.A.K.G.Q.P.R.E.P.Q.V.Y.T.L.P.P.S.R.D.E.L.T.K.N.Q.V.S.L.T.C.L.V.K.G.F.Y.P.S.D.I.A.V.E.W.E.S.N.G.Q.P.E.N.N.Y.K.T.T.P.P.V.L.D.S.D.G.S.F.F.L.Y.S.K.L.T.V.D.K.S.R.W.Q.Q.G.N.V.F.S.C.S.V.M.H.E.A.L.H.N.H.Y.T.Q.K.S.L.S.L.S.P.G}|PEPTIDE3{Q.V.Q.L.V.E.S.G.G.G.V.V.Q.P.G.R.S.L.R.L.S.C.A.A.S.G.F.T.F.S.S.Y.G.M.H.W.V.R.Q.A.P.G.K.G.L.E.W.V.S.F.L.W.Y.D.G.T.N.K.N.Y.V.E.S.V.K.G.R.F.T.I.S.R.D.N.S.K.N.M.L.Y.L.E.M.N.S.L.R.A.E.D.T.A.V.Y.Y.C.A.R.D.H.D.F.R.S.G.Y.E.G.W.F.D.P.W.G.Q.G.T.L.V.T.V.S.S.A.S.T.K.G.P.S.V.F.P.L.A.P.S.S.K.S.T.S.G.G.T.A.A.L.G.C.L.V.K.D.Y.F.P.E.P.V.T.V.S.W.N.S.G.A.L.T.S.G.V.H.T.F.P.A.V.L.Q.S.S.G.L.Y.S.L.S.S.V.V.T.V.P.S.S.S.L.G.T.Q.T.Y.I.C.N.V.N.H.K.P.S.N.T.K.V.D.K.K.V.E.P.K.S.C.D.K.T.H.T.C.P.P.C.P.A.P.E.L.L.G.G.P.S.V.F.L.F.P.P.K.P.K.D.T.L.M.I.S.R.T.P.E.V.T.C.V.V.V.D.V.S.H.E.D.P.E.V.K.F.N.W.Y.V.D.G.V.E.V.H.N.A.K.T.K.P.R.E.E.Q.Y.N.S.T.Y.R.V.V.S.V.L.T.V.L.H.Q.D.W.L.N.G.K.E.Y.K.C.K.V.S.N.K.A.L.P.A.P.I.E.K.T.I.S.K.A.K.G.Q.P.R.E.P.Q.V.Y.T.L.P.P.S.R.D.E.L.T.K.N.Q.V.S.L.T.C.L.V.K.G.F.Y.P.S.D.I.A.V.E.W.E.S.N.G.Q.P.E.N.N.Y.K.T.T.P.P.V.L.D.S.D.G.S.F.F.L.Y.S.K.L.T.V.D.K.S.R.W.Q.Q.G.N.V.F.S.C.S.V.M.H.E.A.L.H.N.H.Y.T.Q.K.S.L.S.L.S.P.G}|PEPTIDE4{E.I.V.L.T.Q.S.P.A.T.L.S.L.S.P.G.E.R.A.T.L.S.C.R.A.S.Q.S.V.S.S.Y.L.A.W.Y.Q.Q.K.P.G.Q.A.P.R.L.L.I.Y.D.A.S.N.R.A.T.G.I.P.A.R.F.S.G.S.G.S.G.T.D.F.T.L.T.I.S.S.L.E.P.E.D.F.A.V.Y.Y.C.Q.H.R.S.N.W.P.P.T.F.G.G.G.T.K.V.E.I.K.R.T.V.A.A.P.S.V.F.I.F.P.P.S.D.E.Q.L.K.S.G.T.A.S.V.V.C.L.L.N.N.F.Y.P.R.E.A.K.V.Q.W.K.V.D.N.A.L.Q.S.G.N.S.Q.E.S.V.T.E.Q.D.S.K.D.S.T.Y.S.L.S.S.T.L.T.L.S.K.A.D.Y.E.K.H.K.V.Y.A.C.E.V.T.H.Q.G.L.S.S.P.V.T.K.S.F.N.R.G.E.C}$PEPTIDE2,PEPTIDE2,22:R3-96:R3|PEPTIDE3,PEPTIDE3,373:R3-431:R3|PEPTIDE4,PEPTIDE4,23:R3-88:R3|PEPTIDE3,PEPTIDE3,150:R3-206:R3|PEPTIDE1,PEPTIDE1,23:R3-88:R3|PEPTIDE3,PEPTIDE3,22:R3-96:R3|PEPTIDE2,PEPTIDE3,235:R3-235:R3|PEPTIDE4,PEPTIDE4,134:R3-194:R3|PEPTIDE2,PEPTIDE2,373:R3-431:R3|PEPTIDE1,PEPTIDE1,134:R3-194:R3|PEPTIDE3,PEPTIDE4,226:R3-214:R3|PEPTIDE2,PEPTIDE2,150:R3-206:R3|PEPTIDE2,PEPTIDE1,226:R3-214:R3|PEPTIDE2,PEPTIDE3,232:R3-232:R3|PEPTIDE3,PEPTIDE3,267:R3-327:R3|PEPTIDE2,PEPTIDE2,267:R3-327:R3$$$

The ChEMBL HELM monomer library is available to download here.

For more details about HELM Notation, please visit the HELM Homepage.

Biological Sequence

Description Sequence
Enoticumab heavy chain QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVSFLWYDGTNKNY VESVKGRFTISRDNSKNMLYLEMNSLRAEDTAVYYCARDHDFRSGYEGWFDPWGQGTLVT VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEL LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS RDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
Enoticumab light chain EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPA RFSGSGSGTDFTLTISSLEPEDFAVYYCQHRSNWPPTFGGGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Compound Cross References

ChemSpider ChemSpider Identifier not yet assigned
spacer
spacer