ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1743087
CHEMBL1743087
Compound Name VEDOLIZUMAB
ChEMBL Synonyms LDP-02 | ENTYVIO | VEDOLIZUMAB | MLN0002 | MLN-02
Max Phase 4 (Approved)
Trade Names ENTYVIO

Sources

  • British National Formulary
  • Clinical Candidates
  • Manually Added Drugs
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1743087 compound icon
Drug Type:Antibody Rule of Five:N First In Class:Y Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:N Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Integrin alpha-4/beta-7 inhibitor Integrin alpha-4/beta-7 FDA

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
Crohn DiseaseD003424EFO:0000384Crohn's disease4ClinicalTrials
DailyMed
HIV InfectionsD015658EFO:0000764HIV infection1ClinicalTrials
MelanomaD008545EFO:0000756melanoma1ClinicalTrials
InfectionD007239EFO:0000544infection2ClinicalTrials
Colitis, UlcerativeD003093EFO:0000729ulcerative colitis3ClinicalTrials
Immune System DiseasesD007154EFO:0000540immune system disease4ATC
Inflammatory Bowel DiseasesD015212EFO:0003767inflammatory bowel disease1ClinicalTrials
Celiac DiseaseD002446EFO:0001060celiac disease2ClinicalTrials

Clinical Data

ClinicalTrials.gov VEDOLIZUMAB
The Cochrane Collaboration VEDOLIZUMAB

HELM Notation

CHEMBL1743087 HELM Notation
PEPTIDE1{D.V.V.M.T.Q.S.P.L.S.L.P.V.T.P.G.E.P.A.S.I.S.C.R.S.S.Q.S.L.A.K.S.Y.G.N.T.Y.L.S.W.Y.L.Q.K.P.G.Q.S.P.Q.L.L.I.Y.G.I.S.N.R.F.S.G.V.P.D.R.F.S.G.S.G.S.G.T.D.F.T.L.K.I.S.R.V.E.A.E.D.V.G.V.Y.Y.C.L.Q.G.T.H.Q.P.Y.T.F.G.Q.G.T.K.V.E.I.K.R.T.V.A.A.P.S.V.F.I.F.P.P.S.D.E.Q.L.K.S.G.T.A.S.V.V.C.L.L.N.N.F.Y.P.R.E.A.K.V.Q.W.K.V.D.N.A.L.Q.S.G.N.S.Q.E.S.V.T.E.Q.D.S.K.D.S.T.Y.S.L.S.S.T.L.T.L.S.K.A.D.Y.E.K.H.K.V.Y.A.C.E.V.T.H.Q.G.L.S.S.P.V.T.K.S.F.N.R.G.E.C}|PEPTIDE2{Q.V.Q.L.V.Q.S.G.A.E.V.K.K.P.G.A.S.V.K.V.S.C.K.G.S.G.Y.T.F.T.S.Y.W.M.H.W.V.R.Q.A.P.G.Q.R.L.E.W.I.G.E.I.D.P.S.E.S.N.T.N.Y.N.Q.K.F.K.G.R.V.T.L.T.V.D.I.S.A.S.T.A.Y.M.E.L.S.S.L.R.S.E.D.T.A.V.Y.Y.C.A.R.G.G.Y.D.G.W.D.Y.A.I.D.Y.W.G.Q.G.T.L.V.T.V.S.S.A.S.T.K.G.P.S.V.F.P.L.A.P.S.S.K.S.T.S.G.G.T.A.A.L.G.C.L.V.K.D.Y.F.P.E.P.V.T.V.S.W.N.S.G.A.L.T.S.G.V.H.T.F.P.A.V.L.Q.S.S.G.L.Y.S.L.S.S.V.V.T.V.P.S.S.S.L.G.T.Q.T.Y.I.C.N.V.N.H.K.P.S.N.T.K.V.D.K.K.V.E.P.K.S.C.D.K.T.H.T.C.P.P.C.P.A.P.E.L.A.G.A.P.S.V.F.L.F.P.P.K.P.K.D.T.L.M.I.S.R.T.P.E.V.T.C.V.V.V.D.V.S.H.E.D.P.E.V.K.F.N.W.Y.V.D.G.V.E.V.H.N.A.K.T.K.P.R.E.E.Q.Y.N.S.T.Y.R.V.V.S.V.L.T.V.L.H.Q.D.W.L.N.G.K.E.Y.K.C.K.V.S.N.K.A.L.P.A.P.I.E.K.T.I.S.K.A.K.G.Q.P.R.E.P.Q.V.Y.T.L.P.P.S.R.D.E.L.T.K.N.Q.V.S.L.T.C.L.V.K.G.F.Y.P.S.D.I.A.V.E.W.E.S.N.G.Q.P.E.N.N.Y.K.T.T.P.P.V.L.D.S.D.G.S.F.F.L.Y.S.K.L.T.V.D.K.S.R.W.Q.Q.G.N.V.F.S.C.S.V.M.H.E.A.L.H.N.H.Y.T.Q.K.S.L.S.L.S.P.G.K}|PEPTIDE3{Q.V.Q.L.V.Q.S.G.A.E.V.K.K.P.G.A.S.V.K.V.S.C.K.G.S.G.Y.T.F.T.S.Y.W.M.H.W.V.R.Q.A.P.G.Q.R.L.E.W.I.G.E.I.D.P.S.E.S.N.T.N.Y.N.Q.K.F.K.G.R.V.T.L.T.V.D.I.S.A.S.T.A.Y.M.E.L.S.S.L.R.S.E.D.T.A.V.Y.Y.C.A.R.G.G.Y.D.G.W.D.Y.A.I.D.Y.W.G.Q.G.T.L.V.T.V.S.S.A.S.T.K.G.P.S.V.F.P.L.A.P.S.S.K.S.T.S.G.G.T.A.A.L.G.C.L.V.K.D.Y.F.P.E.P.V.T.V.S.W.N.S.G.A.L.T.S.G.V.H.T.F.P.A.V.L.Q.S.S.G.L.Y.S.L.S.S.V.V.T.V.P.S.S.S.L.G.T.Q.T.Y.I.C.N.V.N.H.K.P.S.N.T.K.V.D.K.K.V.E.P.K.S.C.D.K.T.H.T.C.P.P.C.P.A.P.E.L.A.G.A.P.S.V.F.L.F.P.P.K.P.K.D.T.L.M.I.S.R.T.P.E.V.T.C.V.V.V.D.V.S.H.E.D.P.E.V.K.F.N.W.Y.V.D.G.V.E.V.H.N.A.K.T.K.P.R.E.E.Q.Y.N.S.T.Y.R.V.V.S.V.L.T.V.L.H.Q.D.W.L.N.G.K.E.Y.K.C.K.V.S.N.K.A.L.P.A.P.I.E.K.T.I.S.K.A.K.G.Q.P.R.E.P.Q.V.Y.T.L.P.P.S.R.D.E.L.T.K.N.Q.V.S.L.T.C.L.V.K.G.F.Y.P.S.D.I.A.V.E.W.E.S.N.G.Q.P.E.N.N.Y.K.T.T.P.P.V.L.D.S.D.G.S.F.F.L.Y.S.K.L.T.V.D.K.S.R.W.Q.Q.G.N.V.F.S.C.S.V.M.H.E.A.L.H.N.H.Y.T.Q.K.S.L.S.L.S.P.G.K}|PEPTIDE4{D.V.V.M.T.Q.S.P.L.S.L.P.V.T.P.G.E.P.A.S.I.S.C.R.S.S.Q.S.L.A.K.S.Y.G.N.T.Y.L.S.W.Y.L.Q.K.P.G.Q.S.P.Q.L.L.I.Y.G.I.S.N.R.F.S.G.V.P.D.R.F.S.G.S.G.S.G.T.D.F.T.L.K.I.S.R.V.E.A.E.D.V.G.V.Y.Y.C.L.Q.G.T.H.Q.P.Y.T.F.G.Q.G.T.K.V.E.I.K.R.T.V.A.A.P.S.V.F.I.F.P.P.S.D.E.Q.L.K.S.G.T.A.S.V.V.C.L.L.N.N.F.Y.P.R.E.A.K.V.Q.W.K.V.D.N.A.L.Q.S.G.N.S.Q.E.S.V.T.E.Q.D.S.K.D.S.T.Y.S.L.S.S.T.L.T.L.S.K.A.D.Y.E.K.H.K.V.Y.A.C.E.V.T.H.Q.G.L.S.S.P.V.T.K.S.F.N.R.G.E.C}$PEPTIDE3,PEPTIDE3,22:R3-96:R3|PEPTIDE4,PEPTIDE4,139:R3-199:R3|PEPTIDE2,PEPTIDE2,265:R3-325:R3|PEPTIDE3,PEPTIDE3,265:R3-325:R3|PEPTIDE3,PEPTIDE4,224:R3-219:R3|PEPTIDE1,PEPTIDE1,23:R3-93:R3|PEPTIDE2,PEPTIDE2,371:R3-429:R3|PEPTIDE3,PEPTIDE3,371:R3-429:R3|PEPTIDE2,PEPTIDE2,22:R3-96:R3|PEPTIDE2,PEPTIDE3,233:R3-233:R3|PEPTIDE2,PEPTIDE1,224:R3-219:R3|PEPTIDE3,PEPTIDE3,148:R3-204:R3|PEPTIDE1,PEPTIDE1,139:R3-199:R3|PEPTIDE2,PEPTIDE2,148:R3-204:R3|PEPTIDE2,PEPTIDE3,230:R3-230:R3|PEPTIDE4,PEPTIDE4,23:R3-93:R3$$$

The ChEMBL HELM monomer library is available to download here.

For more details about HELM Notation, please visit the HELM Homepage.

Biological Sequence

Description Sequence
Vedolizumab heavy chain QVQLVQSGAEVKKPGASVKVSCKGSGYTFTSYWMHWVRQAPGQRLEWIGEIDPSESNTNY NQKFKGRVTLTVDISASTAYMELSSLRSEDTAVYYCARGGYDGWDYAIDYWGQGTLVTVS SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELAG APSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Vedolizumab light chain DVVMTQSPLSLPVTPGEPASISCRSSQSLAKSYGNTYLSWYLQKPGQSPQLLIYGISNRF SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCLQGTHQPYTFGQGTKVEIKRTVAAPSV FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Compound Cross References

ATC L - ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS
L04 - IMMUNOSUPPRESSANTS
L04A - IMMUNOSUPPRESSANTS
L04AA - Selective immunosuppressants
L04AA33 - vedolizumab

ChemSpider ChemSpider Identifier not yet assigned
DailyMed vedolizumab
spacer
spacer