ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1743070
CHEMBL1743070
Compound Name SILTUXIMAB
ChEMBL Synonyms SILTUXIMAB | CLLB8 | CNTO-328
Max Phase 4 (Approved)
Trade Names

Sources

  • British National Formulary
  • Clinical Candidates
  • Manually Added Drugs
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1743070 compound icon
Drug Type:Antibody Rule of Five:N First In Class:Y Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:N Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Interleukin-6 inhibitor Interleukin-6 FDA

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
MULTIPLE MYELOMAD009101EFO:0001378MULTIPLE MYELOMA2ClinicalTrials
SCHIZOPHRENIAD012559EFO:0000692SCHIZOPHRENIA1ClinicalTrials
CARCINOMA, RENAL CELLD002292EFO:0000681RENAL CELL CARCINOMA2ClinicalTrials
DIABETES MELLITUS, TYPE 1D003922EFO:0001359TYPE I DIABETES MELLITUS0ClinicalTrials
IMMUNE SYSTEM DISEASESD007154EFO:0000540IMMUNE SYSTEM DISEASE4ATC
GIANT LYMPH NODE HYPERPLASIAD005871EFO:1001332GIANT LYMPH NODE HYPERPLASIA4DailyMed
MYELODYSPLASTIC SYNDROMESD009190EFO:0000198MYELODYSPLASTIC SYNDROME2ClinicalTrials
CARCINOMA, RENAL CELLD002292EFO:0002890RENAL CARCINOMA2ClinicalTrials
PROSTATIC NEOPLASMSD011471EFO:0001663PROSTATE CARCINOMA2ClinicalTrials

Clinical Data

ClinicalTrials.gov SILTUXIMAB
The Cochrane Collaboration SILTUXIMAB

HELM Notation

CHEMBL1743070 HELM Notation
PEPTIDE1{Q.I.V.L.I.Q.S.P.A.I.M.S.A.S.P.G.E.K.V.T.M.T.C.S.A.S.S.S.V.S.Y.M.Y.W.Y.Q.Q.K.P.G.S.S.P.R.L.L.I.Y.D.T.S.N.L.A.S.G.V.P.V.R.F.S.G.S.G.S.G.T.S.Y.S.L.T.I.S.R.M.E.A.E.D.A.A.T.Y.Y.C.Q.Q.W.S.G.Y.P.Y.T.F.G.G.G.T.K.L.E.I.K.R.T.V.A.A.P.S.V.F.I.F.P.P.S.D.E.Q.L.K.S.G.T.A.S.V.V.C.L.L.N.N.F.Y.P.R.E.A.K.V.Q.W.K.V.D.N.A.L.Q.S.G.N.S.Q.E.S.V.T.E.Q.D.S.K.D.S.T.Y.S.L.S.S.T.L.T.L.S.K.A.D.Y.E.K.H.K.V.Y.A.C.E.V.T.H.Q.G.L.S.S.P.V.T.K.S.F.N.R.G.E.C}|PEPTIDE2{E.V.Q.L.V.E.S.G.G.K.L.L.K.P.G.G.S.L.K.L.S.C.A.A.S.G.F.T.F.S.S.F.A.M.S.W.F.R.Q.S.P.E.K.R.L.E.W.V.A.E.I.S.S.G.G.S.Y.T.Y.Y.P.D.T.V.T.G.R.F.T.I.S.R.D.N.A.K.N.T.L.Y.L.E.M.S.S.L.R.S.E.D.T.A.M.Y.Y.C.A.R.G.L.W.G.Y.Y.A.L.D.Y.W.G.Q.G.T.S.V.T.V.S.S.A.S.T.K.G.P.S.V.F.P.L.A.P.S.S.K.S.T.S.G.G.T.A.A.L.G.C.L.V.K.D.Y.F.P.E.P.V.T.V.S.W.N.S.G.A.L.T.S.G.V.H.T.F.P.A.V.L.Q.S.S.G.L.Y.S.L.S.S.V.V.T.V.P.S.S.S.L.G.T.Q.T.Y.I.C.N.V.N.H.K.P.S.N.T.K.V.D.K.K.V.E.P.K.S.C.D.K.T.H.T.C.P.P.C.P.A.P.E.L.L.G.G.P.S.V.F.L.F.P.P.K.P.K.D.T.L.M.I.S.R.T.P.E.V.T.C.V.V.V.D.V.S.H.E.D.P.E.V.K.F.N.W.Y.V.D.G.V.E.V.H.N.A.K.T.K.P.R.E.E.Q.Y.N.S.T.Y.R.V.V.S.V.L.T.V.L.H.Q.D.W.L.N.G.K.E.Y.K.C.K.V.S.N.K.A.L.P.A.P.I.E.K.T.I.S.K.A.K.G.Q.P.R.E.P.Q.V.Y.T.L.P.P.S.R.D.E.L.T.K.N.Q.V.S.L.T.C.L.V.K.G.F.Y.P.S.D.I.A.V.E.W.E.S.N.G.Q.P.E.N.N.Y.K.T.T.P.P.V.L.D.S.D.G.S.F.F.L.Y.S.K.L.T.V.D.K.S.R.W.Q.Q.G.N.V.F.S.C.S.V.M.H.E.A.L.H.N.H.Y.T.Q.K.S.L.S.L.S.P.G.K}|PEPTIDE3{E.V.Q.L.V.E.S.G.G.K.L.L.K.P.G.G.S.L.K.L.S.C.A.A.S.G.F.T.F.S.S.F.A.M.S.W.F.R.Q.S.P.E.K.R.L.E.W.V.A.E.I.S.S.G.G.S.Y.T.Y.Y.P.D.T.V.T.G.R.F.T.I.S.R.D.N.A.K.N.T.L.Y.L.E.M.S.S.L.R.S.E.D.T.A.M.Y.Y.C.A.R.G.L.W.G.Y.Y.A.L.D.Y.W.G.Q.G.T.S.V.T.V.S.S.A.S.T.K.G.P.S.V.F.P.L.A.P.S.S.K.S.T.S.G.G.T.A.A.L.G.C.L.V.K.D.Y.F.P.E.P.V.T.V.S.W.N.S.G.A.L.T.S.G.V.H.T.F.P.A.V.L.Q.S.S.G.L.Y.S.L.S.S.V.V.T.V.P.S.S.S.L.G.T.Q.T.Y.I.C.N.V.N.H.K.P.S.N.T.K.V.D.K.K.V.E.P.K.S.C.D.K.T.H.T.C.P.P.C.P.A.P.E.L.L.G.G.P.S.V.F.L.F.P.P.K.P.K.D.T.L.M.I.S.R.T.P.E.V.T.C.V.V.V.D.V.S.H.E.D.P.E.V.K.F.N.W.Y.V.D.G.V.E.V.H.N.A.K.T.K.P.R.E.E.Q.Y.N.S.T.Y.R.V.V.S.V.L.T.V.L.H.Q.D.W.L.N.G.K.E.Y.K.C.K.V.S.N.K.A.L.P.A.P.I.E.K.T.I.S.K.A.K.G.Q.P.R.E.P.Q.V.Y.T.L.P.P.S.R.D.E.L.T.K.N.Q.V.S.L.T.C.L.V.K.G.F.Y.P.S.D.I.A.V.E.W.E.S.N.G.Q.P.E.N.N.Y.K.T.T.P.P.V.L.D.S.D.G.S.F.F.L.Y.S.K.L.T.V.D.K.S.R.W.Q.Q.G.N.V.F.S.C.S.V.M.H.E.A.L.H.N.H.Y.T.Q.K.S.L.S.L.S.P.G.K}|PEPTIDE4{Q.I.V.L.I.Q.S.P.A.I.M.S.A.S.P.G.E.K.V.T.M.T.C.S.A.S.S.S.V.S.Y.M.Y.W.Y.Q.Q.K.P.G.S.S.P.R.L.L.I.Y.D.T.S.N.L.A.S.G.V.P.V.R.F.S.G.S.G.S.G.T.S.Y.S.L.T.I.S.R.M.E.A.E.D.A.A.T.Y.Y.C.Q.Q.W.S.G.Y.P.Y.T.F.G.G.G.T.K.L.E.I.K.R.T.V.A.A.P.S.V.F.I.F.P.P.S.D.E.Q.L.K.S.G.T.A.S.V.V.C.L.L.N.N.F.Y.P.R.E.A.K.V.Q.W.K.V.D.N.A.L.Q.S.G.N.S.Q.E.S.V.T.E.Q.D.S.K.D.S.T.Y.S.L.S.S.T.L.T.L.S.K.A.D.Y.E.K.H.K.V.Y.A.C.E.V.T.H.Q.G.L.S.S.P.V.T.K.S.F.N.R.G.E.C}$PEPTIDE3,PEPTIDE3,369:R3-427:R3|PEPTIDE2,PEPTIDE2,146:R3-202:R3|PEPTIDE4,PEPTIDE4,133:R3-193:R3|PEPTIDE1,PEPTIDE1,23:R3-87:R3|PEPTIDE2,PEPTIDE2,22:R3-96:R3|PEPTIDE3,PEPTIDE3,263:R3-323:R3|PEPTIDE1,PEPTIDE1,133:R3-193:R3|PEPTIDE2,PEPTIDE1,222:R3-213:R3|PEPTIDE2,PEPTIDE3,231:R3-231:R3|PEPTIDE3,PEPTIDE4,222:R3-213:R3|PEPTIDE3,PEPTIDE3,146:R3-202:R3|PEPTIDE4,PEPTIDE4,23:R3-87:R3|PEPTIDE2,PEPTIDE2,369:R3-427:R3|PEPTIDE2,PEPTIDE3,228:R3-228:R3|PEPTIDE3,PEPTIDE3,22:R3-96:R3|PEPTIDE2,PEPTIDE2,263:R3-323:R3$$$

The ChEMBL HELM monomer library is available to download here.

For more details about HELM Notation, please visit the HELM Homepage.

Biological Sequence

Description Sequence
Siltuximab heavy chain EVQLVESGGKLLKPGGSLKLSCAASGFTFSSFAMSWFRQSPEKRLEWVAEISSGGSYTYY PDTVTGRFTISRDNAKNTLYLEMSSLRSEDTAMYYCARGLWGYYALDYWGQGTSVTVSSA STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGP SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ QGNVFSCSVMHEALHNHYTQKSLSLSPGK
Siltuximab light chain QIVLIQSPAIMSASPGEKVTMTCSASSSVSYMYWYQQKPGSSPRLLIYDTSNLASGVPVR FSGSGSGTSYSLTISRMEAEDAATYYCQQWSGYPYTFGGGTKLEIKRTVAAPSVFIFPPS DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Compound Cross References

ATC L - ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS
L04 - IMMUNOSUPPRESSANTS
L04A - IMMUNOSUPPRESSANTS
L04AC - Interleukin inhibitors
L04AC11 - siltuximab

ChemSpider ChemSpider Identifier not yet assigned
DailyMed siltuximab
spacer
spacer