ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1743062
CHEMBL1743062
Compound Name RAMUCIRUMAB
ChEMBL Synonyms RAMUCIRUMAB | 1121B | IMC-1121B
Max Phase 4 (Approved)
Trade Names

Molecule Features

CHEMBL1743062 compound icon
Drug Type:mAB Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:Y Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Vascular endothelial growth factor receptor 2 inhibitor Vascular endothelial growth factor receptor 2 FDA

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication
ADENOCARCINOMAD000230EFO:0000228ADENOCARCINOMA1
CARCINOMA, HEPATOCELLULARD006528EFO:0000182HEPATOCELLULAR CARCINOMA3
CARCINOMA, NON-SMALL-CELL LUNGD002289EFO:0003060NON-SMALL CELL LUNG CARCINOMA4
CARCINOMA, RENAL CELLD002292EFO:0000681RENAL CELL CARCINOMA2
GLIOMAD005910EFO:0000326CENTRAL NERVOUS SYSTEM CANCER2
NEOPLASMSD009369EFO:0000311CANCER4
NEOPLASMSD009369EFO:0000616NEOPLASM4
PANCREATIC NEOPLASMSD010190EFO:0003860PANCREATIC NEOPLASM2
STOMACH NEOPLASMSD013274EFO:0000178GASTRIC CARCINOMA2
STOMACH NEOPLASMSD013274EFO:0000503GASTRIC ADENOCARCINOMA2

Clinical Data

Number of clinical trials registered at clinicaltrials.gov
Number of reviews at The Cochrane Collaboration
Number of entries at British National Formulary

HELM Notation

CHEMBL1743062 HELM Notation
PEPTIDE1{D.I.Q.M.T.Q.S.P.S.S.V.S.A.S.I.G.D.R.V.T.I.T.C.R.A.S.Q.G.I.D.N.W.L.G.W.Y.Q.Q.K.P.G.K.A.P.K.L.L.I.Y.D.A.S.N.L.D.T.G.V.P.S.R.F.S.G.S.G.S.G.T.Y.F.T.L.T.I.S.S.L.Q.A.E.D.F.A.V.Y.F.C.Q.Q.A.K.A.F.P.P.T.F.G.G.G.T.K.V.D.I.K.G.T.V.A.A.P.S.V.F.I.F.P.P.S.D.E.Q.L.K.S.G.T.A.S.V.V.C.L.L.N.N.F.Y.P.R.E.A.K.V.Q.W.K.V.D.N.A.L.Q.S.G.N.S.Q.E.S.V.T.E.Q.D.S.K.D.S.T.Y.S.L.S.S.T.L.T.L.S.K.A.D.Y.E.K.H.K.V.Y.A.C.E.V.T.H.Q.G.L.S.S.P.V.T.K.S.F.N.R.G.E.C}|PEPTIDE2{E.V.Q.L.V.Q.S.G.G.G.L.V.K.P.G.G.S.L.R.L.S.C.A.A.S.G.F.T.F.S.S.Y.S.M.N.W.V.R.Q.A.P.G.K.G.L.E.W.V.S.S.I.S.S.S.S.S.Y.I.Y.Y.A.D.S.V.K.G.R.F.T.I.S.R.D.N.A.K.N.S.L.Y.L.Q.M.N.S.L.R.A.E.D.T.A.V.Y.Y.C.A.R.V.T.D.A.F.D.I.W.G.Q.G.T.M.V.T.V.S.S.A.S.T.K.G.P.S.V.F.P.L.A.P.S.S.K.S.T.S.G.G.T.A.A.L.G.C.L.V.K.D.Y.F.P.E.P.V.T.V.S.W.N.S.G.A.L.T.S.G.V.H.T.F.P.A.V.L.Q.S.S.G.L.Y.S.L.S.S.V.V.T.V.P.S.S.S.L.G.T.Q.T.Y.I.C.N.V.N.H.K.P.S.N.T.K.V.D.K.K.V.E.P.K.S.C.D.K.T.H.T.C.P.P.C.P.A.P.E.L.L.G.G.P.S.V.F.L.F.P.P.K.P.K.D.T.L.M.I.S.R.T.P.E.V.T.C.V.V.V.D.V.S.H.E.D.P.E.V.K.F.N.W.Y.V.D.G.V.E.V.H.N.A.K.T.K.P.R.E.E.Q.Y.N.S.T.Y.R.V.V.S.V.L.T.V.L.H.Q.D.W.L.N.G.K.E.Y.K.C.K.V.S.N.K.A.L.P.A.P.I.E.K.T.I.S.K.A.K.G.Q.P.R.E.P.Q.V.Y.T.L.P.P.S.R.E.E.M.T.K.N.Q.V.S.L.T.C.L.V.K.G.F.Y.P.S.D.I.A.V.E.W.E.S.N.G.Q.P.E.N.N.Y.K.T.T.P.P.V.L.D.S.D.G.S.F.F.L.Y.S.K.L.T.V.D.K.S.R.W.Q.Q.G.N.V.F.S.C.S.V.M.H.E.A.L.H.N.H.Y.T.Q.K.S.L.S.L.S.P.G.K}|PEPTIDE3{E.V.Q.L.V.Q.S.G.G.G.L.V.K.P.G.G.S.L.R.L.S.C.A.A.S.G.F.T.F.S.S.Y.S.M.N.W.V.R.Q.A.P.G.K.G.L.E.W.V.S.S.I.S.S.S.S.S.Y.I.Y.Y.A.D.S.V.K.G.R.F.T.I.S.R.D.N.A.K.N.S.L.Y.L.Q.M.N.S.L.R.A.E.D.T.A.V.Y.Y.C.A.R.V.T.D.A.F.D.I.W.G.Q.G.T.M.V.T.V.S.S.A.S.T.K.G.P.S.V.F.P.L.A.P.S.S.K.S.T.S.G.G.T.A.A.L.G.C.L.V.K.D.Y.F.P.E.P.V.T.V.S.W.N.S.G.A.L.T.S.G.V.H.T.F.P.A.V.L.Q.S.S.G.L.Y.S.L.S.S.V.V.T.V.P.S.S.S.L.G.T.Q.T.Y.I.C.N.V.N.H.K.P.S.N.T.K.V.D.K.K.V.E.P.K.S.C.D.K.T.H.T.C.P.P.C.P.A.P.E.L.L.G.G.P.S.V.F.L.F.P.P.K.P.K.D.T.L.M.I.S.R.T.P.E.V.T.C.V.V.V.D.V.S.H.E.D.P.E.V.K.F.N.W.Y.V.D.G.V.E.V.H.N.A.K.T.K.P.R.E.E.Q.Y.N.S.T.Y.R.V.V.S.V.L.T.V.L.H.Q.D.W.L.N.G.K.E.Y.K.C.K.V.S.N.K.A.L.P.A.P.I.E.K.T.I.S.K.A.K.G.Q.P.R.E.P.Q.V.Y.T.L.P.P.S.R.E.E.M.T.K.N.Q.V.S.L.T.C.L.V.K.G.F.Y.P.S.D.I.A.V.E.W.E.S.N.G.Q.P.E.N.N.Y.K.T.T.P.P.V.L.D.S.D.G.S.F.F.L.Y.S.K.L.T.V.D.K.S.R.W.Q.Q.G.N.V.F.S.C.S.V.M.H.E.A.L.H.N.H.Y.T.Q.K.S.L.S.L.S.P.G.K}|PEPTIDE4{D.I.Q.M.T.Q.S.P.S.S.V.S.A.S.I.G.D.R.V.T.I.T.C.R.A.S.Q.G.I.D.N.W.L.G.W.Y.Q.Q.K.P.G.K.A.P.K.L.L.I.Y.D.A.S.N.L.D.T.G.V.P.S.R.F.S.G.S.G.S.G.T.Y.F.T.L.T.I.S.S.L.Q.A.E.D.F.A.V.Y.F.C.Q.Q.A.K.A.F.P.P.T.F.G.G.G.T.K.V.D.I.K.G.T.V.A.A.P.S.V.F.I.F.P.P.S.D.E.Q.L.K.S.G.T.A.S.V.V.C.L.L.N.N.F.Y.P.R.E.A.K.V.Q.W.K.V.D.N.A.L.Q.S.G.N.S.Q.E.S.V.T.E.Q.D.S.K.D.S.T.Y.S.L.S.S.T.L.T.L.S.K.A.D.Y.E.K.H.K.V.Y.A.C.E.V.T.H.Q.G.L.S.S.P.V.T.K.S.F.N.R.G.E.C}$PEPTIDE3,PEPTIDE4,219:R3-214:R3|PEPTIDE2,PEPTIDE2,143:R3-199:R3|PEPTIDE1,PEPTIDE1,23:R3-88:R3|PEPTIDE3,PEPTIDE3,366:R3-424:R3|PEPTIDE3,PEPTIDE3,260:R3-320:R3|PEPTIDE2,PEPTIDE3,225:R3-225:R3|PEPTIDE2,PEPTIDE2,366:R3-424:R3|PEPTIDE3,PEPTIDE3,143:R3-199:R3|PEPTIDE4,PEPTIDE4,134:R3-194:R3|PEPTIDE2,PEPTIDE2,260:R3-320:R3|PEPTIDE2,PEPTIDE1,219:R3-214:R3|PEPTIDE1,PEPTIDE1,134:R3-194:R3|PEPTIDE2,PEPTIDE2,22:R3-96:R3|PEPTIDE3,PEPTIDE3,22:R3-96:R3|PEPTIDE2,PEPTIDE3,228:R3-228:R3|PEPTIDE4,PEPTIDE4,23:R3-88:R3$$$

The ChEMBL HELM monomer library is available to download here.

For more details about HELM Notation, please visit the HELM Homepage.

Biological Sequence

Description Sequence
Ramucirumab heavy chain EVQLVQSGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISSSSSYIYY ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARVTDAFDIWGQGTMVTVSSASTK GPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYS LSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVF LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKN QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN VFSCSVMHEALHNHYTQKSLSLSPGK
Ramucirumab light chain DIQMTQSPSSVSASIGDRVTITCRASQGIDNWLGWYQQKPGKAPKLLIYDASNLDTGVPS RFSGSGSGTYFTLTISSLQAEDFAVYFCQQAKAFPPTFGGGTKVDIKGTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Compound Cross References

ATC L - ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS
L01 - ANTINEOPLASTIC AGENTS
L01X - OTHER ANTINEOPLASTIC AGENTS
L01XC - Monoclonal antibodies
L01XC21 - ramucirumab

ChemSpider ChemSpider Identifier not yet assigned
DailyMed ramucirumab
spacer
spacer