ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1743057
CHEMBL1743057
Compound Name PEGSUNERCEPT
ChEMBL Synonyms PEGSUNERCEPT | STNF-RI
Max Phase 2
Trade Names

Sources

  • Clinical Candidates
  • USP Dictionary of USAN and International Drug Names

Molecule Features

CHEMBL1743057 compound icon
Drug Type:Oligopeptide Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:Unclassified Parenteral:Unclassified Topical:Unclassified Black Box:Unclassified Availability Type:Unclassified

Mechanism of Action

Mechanism of Action ChEMBL Target References
TNF-alpha inhibitor TNF-alpha PubMed

Clinical Data

ClinicalTrials.gov PEGSUNERCEPT
The Cochrane Collaboration PEGSUNERCEPT

Biological Sequence

Description Sequence
Pegsunercept fusion protein MDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHC LSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFN

Compound Cross References

ChemSpider ChemSpider Identifier not yet assigned
spacer
spacer