ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1743048
CHEMBL1743048
Compound Name OBINUTUZUMAB
ChEMBL Synonyms Afutuzumab | RO 5072759 HUMAB | RG-7159 | HUMABCD20 | GA-101 | R-7159 | HUMAB | GAZYVARO | RO 5072759 | OBINUTUZUMAB
Max Phase 4 (Approved)
Trade Names GAZYVARO

Sources

  • British National Formulary
  • Clinical Candidates
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1743048 compound icon
Drug Type:Antibody Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:Y Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
B-lymphocyte antigen CD20 inhibitor B-lymphocyte antigen CD20 FDA PubMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
Graft vs Host DiseaseD006086EFO:0004599acute graft vs. host disease2ClinicalTrials
Lymphoma, Large B-Cell, DiffuseD016403EFO:0000403diffuse large B-cell lymphoma3ClinicalTrials
Lymphoma, Non-HodgkinD008228EFO:0005952non-Hodgkins lymphoma3ClinicalTrials
Burkitt LymphomaD002051EFO:0000309Burkitts lymphoma1ClinicalTrials
Leukemia, Lymphocytic, Chronic, B-CellD015451EFO:0000095chronic lymphocytic leukemia4ClinicalTrials
DailyMed
Lupus NephritisD008181EFO:0005761lupus nephritis2ClinicalTrials
NeoplasmsD009369EFO:0000616neoplasm4ATC
ClinicalTrials
Lymphoma, FollicularD008224EFO:0000096neoplasm of mature B-cells2ClinicalTrials
Lymphoproliferative DisordersD0082322ClinicalTrials
LymphomaD008223EFO:0000574lymphoma2ClinicalTrials
Lymphoma, Mantle-CellD020522EFO:1001469Mantle cell lymphoma2ClinicalTrials
NeoplasmsD009369EFO:0000311cancer4ClinicalTrials
LeukemiaD007938EFO:0000565leukemia2ClinicalTrials
Leukemia, LymphoidD007945EFO:0004289lymphoid leukemia1ClinicalTrials
Waldenstrom MacroglobulinemiaD008258EFO:0002616macroglobulinemia2ClinicalTrials

Clinical Data

ClinicalTrials.gov OBINUTUZUMAB
The Cochrane Collaboration OBINUTUZUMAB

HELM Notation

CHEMBL1743048 HELM Notation
PEPTIDE1{D.I.V.M.T.Q.T.P.L.S.L.P.V.T.P.G.E.P.A.S.I.S.C.R.S.S.K.S.L.L.H.S.N.G.I.T.Y.L.Y.W.Y.L.Q.K.P.G.Q.S.P.Q.L.L.I.Y.Q.M.S.N.L.V.S.G.V.P.D.R.F.S.G.S.G.S.G.T.D.F.T.L.K.I.S.R.V.E.A.E.D.V.G.V.Y.Y.C.A.Q.N.L.E.L.P.Y.T.F.G.G.G.T.K.V.E.I.K.R.T.V.A.A.P.S.V.F.I.F.P.P.S.D.E.Q.L.K.S.G.T.A.S.V.V.C.L.L.N.N.F.Y.P.R.E.A.K.V.Q.W.K.V.D.N.A.L.Q.S.G.N.S.Q.E.S.V.T.E.Q.D.S.K.D.S.T.Y.S.L.S.S.T.L.T.L.S.K.A.D.Y.E.K.H.K.V.Y.A.C.E.V.T.H.Q.G.L.S.S.P.V.T.K.S.F.N.R.G.E.C}|PEPTIDE2{Q.V.Q.L.V.Q.S.G.A.E.V.K.K.P.G.S.S.V.K.V.S.C.K.A.S.G.Y.A.F.S.Y.S.W.I.N.W.V.R.Q.A.P.G.Q.G.L.E.W.M.G.R.I.F.P.G.D.G.D.T.D.Y.N.G.K.F.K.G.R.V.T.I.T.A.D.K.S.T.S.T.A.Y.M.E.L.S.S.L.R.S.E.D.T.A.V.Y.Y.C.A.R.N.V.F.D.G.Y.W.L.V.Y.W.G.Q.G.T.L.V.T.V.S.S.A.S.T.K.G.P.S.V.F.P.L.A.P.S.S.K.S.T.S.G.G.T.A.A.L.G.C.L.V.K.D.Y.F.P.E.P.V.T.V.S.W.N.S.G.A.L.T.S.G.V.H.T.F.P.A.V.L.Q.S.S.G.L.Y.S.L.S.S.V.V.T.V.P.S.S.S.L.G.T.Q.T.Y.I.C.N.V.N.H.K.P.S.N.T.K.V.D.K.K.V.E.P.K.S.C.D.K.T.H.T.C.P.P.C.P.A.P.E.L.L.G.G.P.S.V.F.L.F.P.P.K.P.K.D.T.L.M.I.S.R.T.P.E.V.T.C.V.V.V.D.V.S.H.E.D.P.E.V.K.F.N.W.Y.V.D.G.V.E.V.H.N.A.K.T.K.P.R.E.E.Q.Y.N.S.T.Y.R.V.V.S.V.L.T.V.L.H.Q.D.W.L.N.G.K.E.Y.K.C.K.V.S.N.K.A.L.P.A.P.I.E.K.T.I.S.K.A.K.G.Q.P.R.E.P.Q.V.Y.T.L.P.P.S.R.D.E.L.T.K.N.Q.V.S.L.T.C.L.V.K.G.F.Y.P.S.D.I.A.V.E.W.E.S.N.G.Q.P.E.N.N.Y.K.T.T.P.P.V.L.D.S.D.G.S.F.F.L.Y.S.K.L.T.V.D.K.S.R.W.Q.Q.G.N.V.F.S.C.S.V.M.H.E.A.L.H.N.H.Y.T.Q.K.S.L.S.L.S.P.G.K}|PEPTIDE3{Q.V.Q.L.V.Q.S.G.A.E.V.K.K.P.G.S.S.V.K.V.S.C.K.A.S.G.Y.A.F.S.Y.S.W.I.N.W.V.R.Q.A.P.G.Q.G.L.E.W.M.G.R.I.F.P.G.D.G.D.T.D.Y.N.G.K.F.K.G.R.V.T.I.T.A.D.K.S.T.S.T.A.Y.M.E.L.S.S.L.R.S.E.D.T.A.V.Y.Y.C.A.R.N.V.F.D.G.Y.W.L.V.Y.W.G.Q.G.T.L.V.T.V.S.S.A.S.T.K.G.P.S.V.F.P.L.A.P.S.S.K.S.T.S.G.G.T.A.A.L.G.C.L.V.K.D.Y.F.P.E.P.V.T.V.S.W.N.S.G.A.L.T.S.G.V.H.T.F.P.A.V.L.Q.S.S.G.L.Y.S.L.S.S.V.V.T.V.P.S.S.S.L.G.T.Q.T.Y.I.C.N.V.N.H.K.P.S.N.T.K.V.D.K.K.V.E.P.K.S.C.D.K.T.H.T.C.P.P.C.P.A.P.E.L.L.G.G.P.S.V.F.L.F.P.P.K.P.K.D.T.L.M.I.S.R.T.P.E.V.T.C.V.V.V.D.V.S.H.E.D.P.E.V.K.F.N.W.Y.V.D.G.V.E.V.H.N.A.K.T.K.P.R.E.E.Q.Y.N.S.T.Y.R.V.V.S.V.L.T.V.L.H.Q.D.W.L.N.G.K.E.Y.K.C.K.V.S.N.K.A.L.P.A.P.I.E.K.T.I.S.K.A.K.G.Q.P.R.E.P.Q.V.Y.T.L.P.P.S.R.D.E.L.T.K.N.Q.V.S.L.T.C.L.V.K.G.F.Y.P.S.D.I.A.V.E.W.E.S.N.G.Q.P.E.N.N.Y.K.T.T.P.P.V.L.D.S.D.G.S.F.F.L.Y.S.K.L.T.V.D.K.S.R.W.Q.Q.G.N.V.F.S.C.S.V.M.H.E.A.L.H.N.H.Y.T.Q.K.S.L.S.L.S.P.G.K}|PEPTIDE4{D.I.V.M.T.Q.T.P.L.S.L.P.V.T.P.G.E.P.A.S.I.S.C.R.S.S.K.S.L.L.H.S.N.G.I.T.Y.L.Y.W.Y.L.Q.K.P.G.Q.S.P.Q.L.L.I.Y.Q.M.S.N.L.V.S.G.V.P.D.R.F.S.G.S.G.S.G.T.D.F.T.L.K.I.S.R.V.E.A.E.D.V.G.V.Y.Y.C.A.Q.N.L.E.L.P.Y.T.F.G.G.G.T.K.V.E.I.K.R.T.V.A.A.P.S.V.F.I.F.P.P.S.D.E.Q.L.K.S.G.T.A.S.V.V.C.L.L.N.N.F.Y.P.R.E.A.K.V.Q.W.K.V.D.N.A.L.Q.S.G.N.S.Q.E.S.V.T.E.Q.D.S.K.D.S.T.Y.S.L.S.S.T.L.T.L.S.K.A.D.Y.E.K.H.K.V.Y.A.C.E.V.T.H.Q.G.L.S.S.P.V.T.K.S.F.N.R.G.E.C}$PEPTIDE1,PEPTIDE1,139:R3-199:R3|PEPTIDE2,PEPTIDE2,22:R3-96:R3|PEPTIDE2,PEPTIDE2,263:R3-323:R3|PEPTIDE2,PEPTIDE3,228:R3-228:R3|PEPTIDE3,PEPTIDE3,146:R3-202:R3|PEPTIDE3,PEPTIDE4,222:R3-219:R3|PEPTIDE2,PEPTIDE2,369:R3-427:R3|PEPTIDE2,PEPTIDE3,231:R3-231:R3|PEPTIDE4,PEPTIDE4,23:R3-93:R3|PEPTIDE3,PEPTIDE3,263:R3-323:R3|PEPTIDE3,PEPTIDE3,22:R3-96:R3|PEPTIDE3,PEPTIDE3,369:R3-427:R3|PEPTIDE2,PEPTIDE1,222:R3-219:R3|PEPTIDE1,PEPTIDE1,23:R3-93:R3|PEPTIDE4,PEPTIDE4,139:R3-199:R3|PEPTIDE2,PEPTIDE2,146:R3-202:R3$$$

The ChEMBL HELM monomer library is available to download here.

For more details about HELM Notation, please visit the HELM Homepage.

Biological Sequence

Description Sequence
Obinutuzumab heavy chain QVQLVQSGAEVKKPGSSVKVSCKASGYAFSYSWINWVRQAPGQGLEWMGRIFPGDGDTDY NGKFKGRVTITADKSTSTAYMELSSLRSEDTAVYYCARNVFDGYWLVYWGQGTLVTVSSA STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGP SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ QGNVFSCSVMHEALHNHYTQKSLSLSPGK
Obinutuzumab light chain DIVMTQTPLSLPVTPGEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLV SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCAQNLELPYTFGGGTKVEIKRTVAAPSV FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Compound Cross References

ATC L - ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS
L01 - ANTINEOPLASTIC AGENTS
L01X - OTHER ANTINEOPLASTIC AGENTS
L01XC - Monoclonal antibodies
L01XC15 - obinutuzumab

ChemSpider ChemSpider Identifier not yet assigned
DailyMed obinutuzumab
spacer
spacer