ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1743047
CHEMBL1743047
Compound Name NECITUMUMAB
ChEMBL Synonyms IMC-11F8 | 11F8 | NECITUMUMAB
Max Phase 4 (Approved)
Trade Names

Sources

  • Clinical Candidates
  • Manually Added Drugs
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1743047 compound icon
Drug Type:Antibody Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:Y Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Epidermal growth factor receptor erbB1 inhibitor Epidermal growth factor receptor erbB1 DailyMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
NeoplasmsD009369EFO:0000616neoplasm4ATC
ClinicalTrials
Carcinoma, Non-Small-Cell LungD002289EFO:0003060non-small cell lung carcinoma4ClinicalTrials
DailyMed
Carcinoma, Squamous CellD002294EFO:0000707squamous cell carcinoma1ClinicalTrials

Clinical Data

ClinicalTrials.gov NECITUMUMAB
The Cochrane Collaboration NECITUMUMAB

HELM Notation

CHEMBL1743047 HELM Notation
PEPTIDE1{E.I.V.M.T.Q.S.P.A.T.L.S.L.S.P.G.E.R.A.T.L.S.C.R.A.S.Q.S.V.S.S.Y.L.A.W.Y.Q.Q.K.P.G.Q.A.P.R.L.L.I.Y.D.A.S.N.R.A.T.G.I.P.A.R.F.S.G.S.G.S.G.T.D.F.T.L.T.I.S.S.L.E.P.E.D.F.A.V.Y.Y.C.H.Q.Y.G.S.T.P.L.T.F.G.G.G.T.K.A.E.I.K.R.T.V.A.A.P.S.V.F.I.F.P.P.S.D.E.Q.L.K.S.G.T.A.S.V.V.C.L.L.N.N.F.Y.P.R.E.A.K.V.Q.W.K.V.D.N.A.L.Q.S.G.N.S.Q.E.S.V.T.E.Q.D.S.K.D.S.T.Y.S.L.S.S.T.L.T.L.S.K.A.D.Y.E.K.H.K.V.Y.A.C.E.V.T.H.Q.G.L.S.S.P.V.T.K.S.F.N.R.G.E.C}|PEPTIDE2{Q.V.Q.L.Q.E.S.G.P.G.L.V.K.P.S.Q.T.L.S.L.T.C.T.V.S.G.G.S.I.S.S.G.D.Y.Y.W.S.W.I.R.Q.P.P.G.K.G.L.E.W.I.G.Y.I.Y.Y.S.G.S.T.D.Y.N.P.S.L.K.S.R.V.T.M.S.V.D.T.S.K.N.Q.F.S.L.K.V.N.S.V.T.A.A.D.T.A.V.Y.Y.C.A.R.V.S.I.F.G.V.G.T.F.D.Y.W.G.Q.G.T.L.V.T.V.S.S.A.S.T.K.G.P.S.V.L.P.L.A.P.S.S.K.S.T.S.G.G.T.A.A.L.G.C.L.V.K.D.Y.F.P.E.P.V.T.V.S.W.N.S.G.A.L.T.S.G.V.H.T.F.P.A.V.L.Q.S.S.G.L.Y.S.L.S.S.V.V.T.V.P.S.S.S.L.G.T.Q.T.Y.I.C.N.V.N.H.K.P.S.N.T.K.V.D.K.R.V.E.P.K.S.C.D.K.T.H.T.C.P.P.C.P.A.P.E.L.L.G.G.P.S.V.F.L.F.P.P.K.P.K.D.T.L.M.I.S.R.T.P.E.V.T.C.V.V.V.D.V.S.H.E.D.P.E.V.K.F.N.W.Y.V.D.G.V.E.V.H.N.A.K.T.K.P.R.E.E.Q.Y.N.S.T.Y.R.V.V.S.V.L.T.V.L.H.Q.D.W.L.N.G.K.E.Y.K.C.K.V.S.N.K.A.L.P.A.P.I.E.K.T.I.S.K.A.K.G.Q.P.R.E.P.Q.V.Y.T.L.P.P.S.R.E.E.M.T.K.N.Q.V.S.L.T.C.L.V.K.G.F.Y.P.S.D.I.A.V.E.W.E.S.N.G.Q.P.E.N.N.Y.K.T.T.P.P.V.L.D.S.D.G.S.F.F.L.Y.S.K.L.T.V.D.K.S.R.W.Q.Q.G.N.V.F.S.C.S.V.M.H.E.A.L.H.N.H.Y.T.Q.K.S.L.S.L.S.P.G.K}|PEPTIDE3{Q.V.Q.L.Q.E.S.G.P.G.L.V.K.P.S.Q.T.L.S.L.T.C.T.V.S.G.G.S.I.S.S.G.D.Y.Y.W.S.W.I.R.Q.P.P.G.K.G.L.E.W.I.G.Y.I.Y.Y.S.G.S.T.D.Y.N.P.S.L.K.S.R.V.T.M.S.V.D.T.S.K.N.Q.F.S.L.K.V.N.S.V.T.A.A.D.T.A.V.Y.Y.C.A.R.V.S.I.F.G.V.G.T.F.D.Y.W.G.Q.G.T.L.V.T.V.S.S.A.S.T.K.G.P.S.V.L.P.L.A.P.S.S.K.S.T.S.G.G.T.A.A.L.G.C.L.V.K.D.Y.F.P.E.P.V.T.V.S.W.N.S.G.A.L.T.S.G.V.H.T.F.P.A.V.L.Q.S.S.G.L.Y.S.L.S.S.V.V.T.V.P.S.S.S.L.G.T.Q.T.Y.I.C.N.V.N.H.K.P.S.N.T.K.V.D.K.R.V.E.P.K.S.C.D.K.T.H.T.C.P.P.C.P.A.P.E.L.L.G.G.P.S.V.F.L.F.P.P.K.P.K.D.T.L.M.I.S.R.T.P.E.V.T.C.V.V.V.D.V.S.H.E.D.P.E.V.K.F.N.W.Y.V.D.G.V.E.V.H.N.A.K.T.K.P.R.E.E.Q.Y.N.S.T.Y.R.V.V.S.V.L.T.V.L.H.Q.D.W.L.N.G.K.E.Y.K.C.K.V.S.N.K.A.L.P.A.P.I.E.K.T.I.S.K.A.K.G.Q.P.R.E.P.Q.V.Y.T.L.P.P.S.R.E.E.M.T.K.N.Q.V.S.L.T.C.L.V.K.G.F.Y.P.S.D.I.A.V.E.W.E.S.N.G.Q.P.E.N.N.Y.K.T.T.P.P.V.L.D.S.D.G.S.F.F.L.Y.S.K.L.T.V.D.K.S.R.W.Q.Q.G.N.V.F.S.C.S.V.M.H.E.A.L.H.N.H.Y.T.Q.K.S.L.S.L.S.P.G.K}|PEPTIDE4{E.I.V.M.T.Q.S.P.A.T.L.S.L.S.P.G.E.R.A.T.L.S.C.R.A.S.Q.S.V.S.S.Y.L.A.W.Y.Q.Q.K.P.G.Q.A.P.R.L.L.I.Y.D.A.S.N.R.A.T.G.I.P.A.R.F.S.G.S.G.S.G.T.D.F.T.L.T.I.S.S.L.E.P.E.D.F.A.V.Y.Y.C.H.Q.Y.G.S.T.P.L.T.F.G.G.G.T.K.A.E.I.K.R.T.V.A.A.P.S.V.F.I.F.P.P.S.D.E.Q.L.K.S.G.T.A.S.V.V.C.L.L.N.N.F.Y.P.R.E.A.K.V.Q.W.K.V.D.N.A.L.Q.S.G.N.S.Q.E.S.V.T.E.Q.D.S.K.D.S.T.Y.S.L.S.S.T.L.T.L.S.K.A.D.Y.E.K.H.K.V.Y.A.C.E.V.T.H.Q.G.L.S.S.P.V.T.K.S.F.N.R.G.E.C}$PEPTIDE3,PEPTIDE4,224:R3-214:R3|PEPTIDE3,PEPTIDE3,22:R3-97:R3|PEPTIDE3,PEPTIDE3,148:R3-204:R3|PEPTIDE3,PEPTIDE3,265:R3-325:R3|PEPTIDE2,PEPTIDE2,371:R3-429:R3|PEPTIDE1,PEPTIDE1,134:R3-194:R3|PEPTIDE2,PEPTIDE3,233:R3-233:R3|PEPTIDE4,PEPTIDE4,23:R3-88:R3|PEPTIDE2,PEPTIDE1,224:R3-214:R3|PEPTIDE2,PEPTIDE2,148:R3-204:R3|PEPTIDE2,PEPTIDE2,22:R3-97:R3|PEPTIDE2,PEPTIDE2,265:R3-325:R3|PEPTIDE2,PEPTIDE3,230:R3-230:R3|PEPTIDE4,PEPTIDE4,134:R3-194:R3|PEPTIDE3,PEPTIDE3,371:R3-429:R3|PEPTIDE1,PEPTIDE1,23:R3-88:R3$$$

The ChEMBL HELM monomer library is available to download here.

For more details about HELM Notation, please visit the HELM Homepage.

Biological Sequence

Description Sequence
Necitumumab heavy chain QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGDYYWSWIRQPPGKGLEWIGYIYYSGSTD YNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYCARVSIFGVGTFDYWGQGTLVTVS SASTKGPSVLPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLG GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRE EMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Necitumumab light chain EIVMTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPA RFSGSGSGTDFTLTISSLEPEDFAVYYCHQYGSTPLTFGGGTKAEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Compound Cross References

ATC L - ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS
L01 - ANTINEOPLASTIC AGENTS
L01X - OTHER ANTINEOPLASTIC AGENTS
L01XC - Monoclonal antibodies
L01XC22 - necitumumab

ChemSpider ChemSpider Identifier not yet assigned
DailyMed necitumumab
spacer
spacer