ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1743034
CHEMBL1743034
Compound Name IXEKIZUMAB
ChEMBL Synonyms IXEKIZUMAB | TALTZ | LY-2439821
Max Phase 4 (Approved)
Trade Names TALTZ

Sources

  • British National Formulary
  • Clinical Candidates
  • Manually Added Drugs
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1743034 compound icon
Drug Type:Antibody Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:N Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Interleukin 17A inhibitor Interleukin 17A FDA

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
Spondylitis, AnkylosingD013167EFO:0003898ankylosing spondylitis3ClinicalTrials
Arthritis, PsoriaticD015535EFO:0003778psoriatic arthritis3ClinicalTrials
PsoriasisD011565EFO:0000676psoriasis4ClinicalTrials
FDA
Arthritis, RheumatoidD001172EFO:0000685rheumatoid arthritis2ClinicalTrials
PyodermaD011711HP:0000999pyoderma2ClinicalTrials
Immune System DiseasesD007154EFO:0000540immune system disease4ATC
Pemphigoid, BullousD010391EFO:0007187bullous pemphigoid2ClinicalTrials

Clinical Data

ClinicalTrials.gov IXEKIZUMAB
The Cochrane Collaboration IXEKIZUMAB

Biological Sequence

Description Sequence
Ixekizumab heavy chain QVQLVQSGAEVKKPGSSVKVSCKASGYSFTDYHIHWVRQAPGQGLEWMGVINPMYGTTDY NQRFKGRVTITADESTSTAYMELSSLRSEDTAVYYCARYDYFTGTGVYWGQGTLVTVSSA STKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG LYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVF LFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYR VVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKN QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGN VFSCSVMHEALHNHYTQKSLSLSLG
Ixekizumab light chain DIVMTQTPLSLSVTPGQPASISCRSSRSLVHSRGNTYLHWYLQKPGQSPQLLIYKVSNRF IGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCSQSTHLPFTFGQGTKLEIKRTVAAPSV FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Compound Cross References

ATC L - ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS
L04 - IMMUNOSUPPRESSANTS
L04A - IMMUNOSUPPRESSANTS
L04AC - Interleukin inhibitors
L04AC13 - ixekizumab

ChemSpider ChemSpider Identifier not yet assigned
DailyMed ixekizumab
spacer
spacer