ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1743013
CHEMBL1743013
Compound Name ENSITUXIMAB
ChEMBL Synonyms NPC-1C | ENSITUXIMAB
Max Phase 1
Trade Names

Sources

  • Clinical Candidates
  • USP Dictionary of USAN and International Drug Names

Molecule Features

CHEMBL1743013 compound icon
Drug Type:Antibody Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:Unclassified Parenteral:Unclassified Topical:Unclassified Black Box:Unclassified Availability Type:Unclassified

Mechanism of Action

Mechanism of Action ChEMBL Target References
Mucin-5AC other Mucin-5AC PubMed PubMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
Pancreatic NeoplasmsD010190EFO:0002618pancreatic carcinoma1ClinicalTrials

Clinical Data

ClinicalTrials.gov ENSITUXIMAB
The Cochrane Collaboration ENSITUXIMAB

Biological Sequence

Description Sequence
Ensituximab heavy chain QVQLKESGPDLVAPSQSLSITCTVSGFSLSKFGVNWVRQPPGKGLEWLGVIWGDGSTSYN SGLISRLSISKENSKSQVFLKLNSLQADDTATYYCVKPGGDYWGHGTSVTVSSASTKGPS VFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGPYSLSS VVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFP PKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVS VLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVS LTCLVKGFYPSDIAVEWESNGQPENNYKTMPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPGK
Ensituximab light chain QVVLTQSPVIMSASPGEKVTMTCSASSSISYMYWYQQKPGTSPKRWIYDTSKLASGVPAR FSGSGSGTSYSLTISNMEAGDAATYYCHQRDSYPWTFGGGTNLEIKRTVAAPSVFIFPPS DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Compound Cross References

ChemSpider ChemSpider Identifier not yet assigned
spacer
spacer