ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1743012
CHEMBL1743012
Compound Name ENOKIZUMAB
ChEMBL Synonyms MEDI-528 | ENOKIZUMAB | 7F3COM-2H2
Max Phase 2
Trade Names

Sources

  • Clinical Candidates
  • USP Dictionary of USAN and International Drug Names

Molecule Features

CHEMBL1743012 compound icon
Drug Type:Antibody Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:Unclassified Parenteral:Unclassified Topical:Unclassified Black Box:Unclassified Availability Type:Unclassified

Mechanism of Action

Mechanism of Action ChEMBL Target References
Interleukin-9 inhibitor Interleukin-9 PubMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
AsthmaD001249EFO:0000270asthma2ClinicalTrials

Clinical Data

ClinicalTrials.gov ENOKIZUMAB
The Cochrane Collaboration ENOKIZUMAB

HELM Notation

CHEMBL1743012 HELM Notation
PEPTIDE1{D.I.Q.M.T.Q.S.P.S.S.L.S.A.S.V.G.D.R.V.T.I.T.C.K.A.S.Q.H.V.I.T.H.V.T.W.Y.Q.Q.K.P.G.K.A.P.K.L.L.I.Y.G.T.S.Y.S.Y.S.G.V.P.S.R.F.S.G.S.G.S.G.T.D.F.T.L.T.I.S.S.L.Q.P.E.D.F.A.T.Y.Y.C.Q.Q.F.Y.E.Y.P.L.T.F.G.G.G.T.K.V.E.I.K.R.T.V.A.A.P.S.V.F.I.F.P.P.S.D.E.Q.L.K.S.G.T.A.S.V.V.C.L.L.N.N.F.Y.P.R.E.A.K.V.Q.W.K.V.E.S.V.T.E.Q.D.S.K.D.S.T.Y.S.L.S.S.T.L.T.L.S.K.A.D.Y.E.K.H.K.V.Y.A.C.E.V.T.H.Q.G.L.S.S.P.V.T.K.S.F.N.R.G.E.C}|PEPTIDE2{Q.V.Q.L.V.Q.S.G.A.E.V.K.K.P.G.S.S.V.K.V.S.C.K.A.S.G.G.T.F.S.Y.Y.W.I.E.W.V.R.Q.A.P.G.Q.G.L.E.W.M.G.E.I.L.P.G.S.G.T.T.N.P.N.E.K.F.K.G.R.V.T.I.T.A.D.E.S.T.S.T.A.Y.M.E.L.S.S.L.R.S.E.D.T.A.V.Y.Y.C.A.R.A.D.Y.Y.G.S.D.Y.V.K.F.D.Y.W.G.Q.G.T.L.V.T.V.S.S.A.S.T.K.G.P.S.V.F.P.L.A.P.S.S.K.S.T.S.G.G.T.A.A.L.G.C.L.V.K.D.Y.F.P.E.P.V.T.V.S.W.N.S.G.A.L.T.S.G.V.H.T.F.P.A.V.L.Q.S.S.G.L.Y.S.L.S.S.V.V.T.V.P.S.S.S.L.G.T.Q.T.Y.I.C.N.V.N.H.K.P.S.N.T.K.V.D.K.R.V.E.P.K.S.C.D.K.T.H.T.C.P.P.C.P.A.P.E.L.L.G.G.P.S.V.F.L.F.P.P.K.P.K.D.T.L.M.I.S.R.T.P.E.V.T.C.V.V.V.D.V.S.H.E.D.P.E.V.K.F.N.W.Y.V.D.G.V.E.V.H.N.A.K.T.K.P.R.E.E.Q.Y.N.S.T.Y.R.V.V.S.V.L.T.V.L.H.Q.D.W.L.N.G.K.E.Y.K.C.K.V.S.N.K.A.L.P.A.P.I.E.K.T.I.S.K.A.K.G.Q.P.R.E.P.Q.V.Y.T.L.P.P.S.R.E.E.M.T.K.N.Q.V.S.L.T.C.L.V.K.G.F.Y.P.S.D.I.A.V.E.W.E.S.N.G.Q.P.E.N.N.Y.K.T.T.P.P.V.L.D.S.D.G.S.F.F.L.Y.S.K.L.T.V.D.K.S.R.W.Q.Q.G.N.V.F.S.C.S.V.M.H.E.A.L.H.N.H.Y.T.Q.K.S.L.S.L.S.P.G.K}|PEPTIDE3{Q.V.Q.L.V.Q.S.G.A.E.V.K.K.P.G.S.S.V.K.V.S.C.K.A.S.G.G.T.F.S.Y.Y.W.I.E.W.V.R.Q.A.P.G.Q.G.L.E.W.M.G.E.I.L.P.G.S.G.T.T.N.P.N.E.K.F.K.G.R.V.T.I.T.A.D.E.S.T.S.T.A.Y.M.E.L.S.S.L.R.S.E.D.T.A.V.Y.Y.C.A.R.A.D.Y.Y.G.S.D.Y.V.K.F.D.Y.W.G.Q.G.T.L.V.T.V.S.S.A.S.T.K.G.P.S.V.F.P.L.A.P.S.S.K.S.T.S.G.G.T.A.A.L.G.C.L.V.K.D.Y.F.P.E.P.V.T.V.S.W.N.S.G.A.L.T.S.G.V.H.T.F.P.A.V.L.Q.S.S.G.L.Y.S.L.S.S.V.V.T.V.P.S.S.S.L.G.T.Q.T.Y.I.C.N.V.N.H.K.P.S.N.T.K.V.D.K.R.V.E.P.K.S.C.D.K.T.H.T.C.P.P.C.P.A.P.E.L.L.G.G.P.S.V.F.L.F.P.P.K.P.K.D.T.L.M.I.S.R.T.P.E.V.T.C.V.V.V.D.V.S.H.E.D.P.E.V.K.F.N.W.Y.V.D.G.V.E.V.H.N.A.K.T.K.P.R.E.E.Q.Y.N.S.T.Y.R.V.V.S.V.L.T.V.L.H.Q.D.W.L.N.G.K.E.Y.K.C.K.V.S.N.K.A.L.P.A.P.I.E.K.T.I.S.K.A.K.G.Q.P.R.E.P.Q.V.Y.T.L.P.P.S.R.E.E.M.T.K.N.Q.V.S.L.T.C.L.V.K.G.F.Y.P.S.D.I.A.V.E.W.E.S.N.G.Q.P.E.N.N.Y.K.T.T.P.P.V.L.D.S.D.G.S.F.F.L.Y.S.K.L.T.V.D.K.S.R.W.Q.Q.G.N.V.F.S.C.S.V.M.H.E.A.L.H.N.H.Y.T.Q.K.S.L.S.L.S.P.G.K}|PEPTIDE4{D.I.Q.M.T.Q.S.P.S.S.L.S.A.S.V.G.D.R.V.T.I.T.C.K.A.S.Q.H.V.I.T.H.V.T.W.Y.Q.Q.K.P.G.K.A.P.K.L.L.I.Y.G.T.S.Y.S.Y.S.G.V.P.S.R.F.S.G.S.G.S.G.T.D.F.T.L.T.I.S.S.L.Q.P.E.D.F.A.T.Y.Y.C.Q.Q.F.Y.E.Y.P.L.T.F.G.G.G.T.K.V.E.I.K.R.T.V.A.A.P.S.V.F.I.F.P.P.S.D.E.Q.L.K.S.G.T.A.S.V.V.C.L.L.N.N.F.Y.P.R.E.A.K.V.Q.W.K.V.E.S.V.T.E.Q.D.S.K.D.S.T.Y.S.L.S.S.T.L.T.L.S.K.A.D.Y.E.K.H.K.V.Y.A.C.E.V.T.H.Q.G.L.S.S.P.V.T.K.S.F.N.R.G.E.C}$PEPTIDE2,PEPTIDE2,22:R3-96:R3|PEPTIDE2,PEPTIDE3,231:R3-231:R3|PEPTIDE2,PEPTIDE2,372:R3-430:R3|PEPTIDE3,PEPTIDE3,149:R3-205:R3|PEPTIDE3,PEPTIDE3,372:R3-430:R3|PEPTIDE3,PEPTIDE3,22:R3-96:R3|PEPTIDE3,PEPTIDE4,225:R3-204:R3|PEPTIDE2,PEPTIDE3,234:R3-234:R3|PEPTIDE2,PEPTIDE2,149:R3-205:R3|PEPTIDE2,PEPTIDE1,225:R3-204:R3|PEPTIDE4,PEPTIDE4,134:R3-184:R3|PEPTIDE3,PEPTIDE3,266:R3-326:R3|PEPTIDE2,PEPTIDE2,266:R3-326:R3|PEPTIDE1,PEPTIDE1,134:R3-184:R3|PEPTIDE1,PEPTIDE1,23:R3-88:R3|PEPTIDE4,PEPTIDE4,23:R3-88:R3$$$

The ChEMBL HELM monomer library is available to download here.

For more details about HELM Notation, please visit the HELM Homepage.

Biological Sequence

Description Sequence
Enokizumab heavy chain QVQLVQSGAEVKKPGSSVKVSCKASGGTFSYYWIEWVRQAPGQGLEWMGEILPGSGTTNP NEKFKGRVTITADESTSTAYMELSSLRSEDTAVYYCARADYYGSDYVKFDYWGQGTLVTV SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELL GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR EEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Enokizumab light chain DIQMTQSPSSLSASVGDRVTITCKASQHVITHVTWYQQKPGKAPKLLIYGTSYSYSGVPS RFSGSGSGTDFTLTISSLQPEDFATYYCQQFYEYPLTFGGGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVESVTEQDSKDSTYSLSSTLTLSKADYEKHK VYACEVTHQGLSSPVTKSFNRGEC

Compound Cross References

ChemSpider ChemSpider Identifier not yet assigned
spacer
spacer