ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1743008
CHEMBL1743008
Compound Name DROZITUMAB
ChEMBL Synonyms PRO-95780 | DROZITUMAB | ANTI-DR5 RHUMAB-DR5
Max Phase 2
Trade Names

Sources

  • Clinical Candidates
  • USP Dictionary of USAN and International Drug Names

Molecule Features

CHEMBL1743008 compound icon
Drug Type:Antibody Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:Unclassified Parenteral:Unclassified Topical:Unclassified Black Box:Unclassified Availability Type:Unclassified

Mechanism of Action

Mechanism of Action ChEMBL Target References
Tumor necrosis factor receptor superfamily member 10B agonist Tumor necrosis factor receptor superfamily member 10B PubMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
Carcinoma, Non-Small-Cell LungD002289EFO:0003060non-small cell lung carcinoma2ClinicalTrials
ChondrosarcomaD002813EFO:0000333chondrosarcoma2ClinicalTrials
Colorectal NeoplasmsD015179EFO:1001951colorectal carcinoma1ClinicalTrials
Lymphoma, Non-HodgkinD008228EFO:0005952non-Hodgkins lymphoma2ClinicalTrials

Clinical Data

ClinicalTrials.gov DROZITUMAB
The Cochrane Collaboration DROZITUMAB

HELM Notation

CHEMBL1743008 HELM Notation
PEPTIDE1{S.E.L.T.Q.D.P.A.V.S.V.A.L.G.Q.T.V.R.I.T.C.S.G.D.S.L.R.S.Y.Y.A.S.W.Y.Q.Q.K.P.G.Q.A.P.V.L.V.I.Y.G.A.N.N.R.P.S.G.I.P.D.R.F.S.G.S.S.S.G.N.T.A.S.L.T.I.T.G.A.Q.A.E.D.E.A.D.Y.Y.C.N.S.A.D.S.S.G.N.H.V.V.F.G.G.G.T.K.L.T.V.L.G.Q.P.K.A.A.P.S.V.T.L.F.P.P.S.S.E.E.L.Q.A.N.K.A.T.L.V.C.L.I.S.D.F.Y.P.G.A.V.T.V.A.W.K.A.D.S.S.P.V.K.A.G.V.E.T.T.T.P.S.K.Q.S.N.N.K.Y.A.A.S.S.Y.L.S.L.T.P.E.Q.W.K.S.H.K.S.Y.S.C.Q.V.T.H.E.G.S.T.V.E.K.T.V.A.P.T.E.C.S}|PEPTIDE2{E.V.Q.L.V.Q.S.G.G.G.V.E.R.P.G.G.S.L.R.L.S.C.A.A.S.G.F.T.F.D.D.Y.A.M.S.W.V.R.Q.A.P.G.K.G.L.E.W.V.S.G.I.N.W.Q.G.G.S.T.G.Y.A.D.S.V.K.G.R.V.T.I.S.R.D.N.A.K.N.S.L.Y.L.Q.M.N.S.L.R.A.E.D.T.A.V.Y.Y.C.A.K.I.L.G.A.G.R.G.W.Y.F.D.Y.W.G.K.G.T.T.V.T.V.S.S.A.S.T.K.G.P.S.V.F.P.L.A.P.S.S.K.S.T.S.G.G.T.A.A.L.G.C.L.V.K.D.Y.F.P.E.P.V.T.V.S.W.N.S.G.A.L.T.S.G.V.H.T.F.P.A.V.L.Q.S.S.G.L.Y.S.L.S.S.V.V.T.V.P.S.S.S.L.G.T.Q.T.Y.I.C.N.V.N.H.K.P.S.N.T.K.V.D.K.K.V.E.P.K.S.C.D.K.T.H.T.C.P.P.C.P.A.P.E.L.L.G.G.P.S.V.F.L.F.P.P.K.P.K.D.T.L.M.I.S.R.T.P.E.V.T.C.V.V.V.D.V.S.H.E.D.P.E.V.K.F.N.W.Y.V.D.G.V.E.V.H.N.A.K.T.K.P.R.E.E.Q.Y.N.S.T.Y.R.V.V.S.V.L.T.V.L.H.Q.D.W.L.N.G.K.E.Y.K.C.K.V.S.N.K.A.L.P.A.P.I.E.K.T.I.S.K.A.K.G.Q.P.R.E.P.Q.V.Y.T.L.P.P.S.R.E.E.M.T.K.N.Q.V.S.L.T.C.L.V.K.G.F.Y.P.S.D.I.A.V.E.W.E.S.N.G.Q.P.E.N.N.Y.K.T.T.P.P.V.L.D.S.D.G.S.F.F.L.Y.S.K.L.T.V.D.K.S.R.W.Q.Q.G.N.V.F.S.C.S.V.M.H.E.A.L.H.N.H.Y.T.Q.K.S.L.S.L.S.P.G.K}|PEPTIDE3{E.V.Q.L.V.Q.S.G.G.G.V.E.R.P.G.G.S.L.R.L.S.C.A.A.S.G.F.T.F.D.D.Y.A.M.S.W.V.R.Q.A.P.G.K.G.L.E.W.V.S.G.I.N.W.Q.G.G.S.T.G.Y.A.D.S.V.K.G.R.V.T.I.S.R.D.N.A.K.N.S.L.Y.L.Q.M.N.S.L.R.A.E.D.T.A.V.Y.Y.C.A.K.I.L.G.A.G.R.G.W.Y.F.D.Y.W.G.K.G.T.T.V.T.V.S.S.A.S.T.K.G.P.S.V.F.P.L.A.P.S.S.K.S.T.S.G.G.T.A.A.L.G.C.L.V.K.D.Y.F.P.E.P.V.T.V.S.W.N.S.G.A.L.T.S.G.V.H.T.F.P.A.V.L.Q.S.S.G.L.Y.S.L.S.S.V.V.T.V.P.S.S.S.L.G.T.Q.T.Y.I.C.N.V.N.H.K.P.S.N.T.K.V.D.K.K.V.E.P.K.S.C.D.K.T.H.T.C.P.P.C.P.A.P.E.L.L.G.G.P.S.V.F.L.F.P.P.K.P.K.D.T.L.M.I.S.R.T.P.E.V.T.C.V.V.V.D.V.S.H.E.D.P.E.V.K.F.N.W.Y.V.D.G.V.E.V.H.N.A.K.T.K.P.R.E.E.Q.Y.N.S.T.Y.R.V.V.S.V.L.T.V.L.H.Q.D.W.L.N.G.K.E.Y.K.C.K.V.S.N.K.A.L.P.A.P.I.E.K.T.I.S.K.A.K.G.Q.P.R.E.P.Q.V.Y.T.L.P.P.S.R.E.E.M.T.K.N.Q.V.S.L.T.C.L.V.K.G.F.Y.P.S.D.I.A.V.E.W.E.S.N.G.Q.P.E.N.N.Y.K.T.T.P.P.V.L.D.S.D.G.S.F.F.L.Y.S.K.L.T.V.D.K.S.R.W.Q.Q.G.N.V.F.S.C.S.V.M.H.E.A.L.H.N.H.Y.T.Q.K.S.L.S.L.S.P.G.K}|PEPTIDE4{S.E.L.T.Q.D.P.A.V.S.V.A.L.G.Q.T.V.R.I.T.C.S.G.D.S.L.R.S.Y.Y.A.S.W.Y.Q.Q.K.P.G.Q.A.P.V.L.V.I.Y.G.A.N.N.R.P.S.G.I.P.D.R.F.S.G.S.S.S.G.N.T.A.S.L.T.I.T.G.A.Q.A.E.D.E.A.D.Y.Y.C.N.S.A.D.S.S.G.N.H.V.V.F.G.G.G.T.K.L.T.V.L.G.Q.P.K.A.A.P.S.V.T.L.F.P.P.S.S.E.E.L.Q.A.N.K.A.T.L.V.C.L.I.S.D.F.Y.P.G.A.V.T.V.A.W.K.A.D.S.S.P.V.K.A.G.V.E.T.T.T.P.S.K.Q.S.N.N.K.Y.A.A.S.S.Y.L.S.L.T.P.E.Q.W.K.S.H.K.S.Y.S.C.Q.V.T.H.E.G.S.T.V.E.K.T.V.A.P.T.E.C.S}$PEPTIDE2,PEPTIDE3,233:R3-233:R3|PEPTIDE3,PEPTIDE3,148:R3-204:R3|PEPTIDE2,PEPTIDE1,224:R3-212:R3|PEPTIDE4,PEPTIDE4,135:R3-194:R3|PEPTIDE4,PEPTIDE4,21:R3-86:R3|PEPTIDE2,PEPTIDE2,148:R3-204:R3|PEPTIDE2,PEPTIDE2,265:R3-325:R3|PEPTIDE2,PEPTIDE3,230:R3-230:R3|PEPTIDE3,PEPTIDE3,22:R3-96:R3|PEPTIDE1,PEPTIDE1,21:R3-86:R3|PEPTIDE1,PEPTIDE1,135:R3-194:R3|PEPTIDE3,PEPTIDE3,371:R3-429:R3|PEPTIDE3,PEPTIDE3,265:R3-325:R3|PEPTIDE3,PEPTIDE4,224:R3-212:R3|PEPTIDE2,PEPTIDE2,22:R3-96:R3|PEPTIDE2,PEPTIDE2,371:R3-429:R3$$$

The ChEMBL HELM monomer library is available to download here.

For more details about HELM Notation, please visit the HELM Homepage.

Biological Sequence

Description Sequence
Drozitumab heavy chain EVQLVQSGGGVERPGGSLRLSCAASGFTFDDYAMSWVRQAPGKGLEWVSGINWQGGSTGY ADSVKGRVTISRDNAKNSLYLQMNSLRAEDTAVYYCAKILGAGRGWYFDYWGKGTTVTVS SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLG GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRE EMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Drozitumab light chain SELTQDPAVSVALGQTVRITCSGDSLRSYYASWYQQKPGQAPVLVIYGANNRPSGIPDRF SGSSSGNTASLTITGAQAEDEADYYCNSADSSGNHVVFGGGTKLTVLGQPKAAPSVTLFP PSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLS LTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS

Compound Cross References

ChemSpider ChemSpider Identifier not yet assigned
spacer
spacer