ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1742982
CHEMBL1742982
Compound Name AFLIBERCEPT
ChEMBL Synonyms AFLIBERCEPT | ZIV-AFLIBERCEPT | ZALTRAP | EYLEA | VEGF TRAP | AVE0005
Max Phase 4 (Approved)
Trade Names ZALTRAP | EYLEA

Sources

  • Clinical Candidates
  • Manually Added Drugs
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1742982 compound icon
Drug Type:Oligopeptide Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:N Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Placenta growth factor inhibitor Placenta growth factor DailyMed DailyMed
Vascular endothelial growth factor A inhibitor Vascular endothelial growth factor A DailyMed DailyMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
Carcinoma, Non-Small-Cell LungD002289EFO:0003060non-small cell lung carcinoma3ClinicalTrials
Glaucoma, NeovascularD015355EFO:1001060neovascular glaucoma3ClinicalTrials
LymphomaD008223EFO:0000574lymphoma1ClinicalTrials
OligodendrogliomaD009837EFO:0002501anaplastic oligodendroglioma2ClinicalTrials
Urinary Bladder NeoplasmsD001749EFO:0000292bladder carcinoma2ClinicalTrials
Adenocarcinoma, FollicularD018263EFO:0000501follicular thyroid carcinoma2ClinicalTrials
Multiple MyelomaD009101EFO:0001378multiple myeloma2ClinicalTrials
NeoplasmsD009369EFO:0000311cancer4ClinicalTrials
Small Cell Lung CarcinomaD055752EFO:0000702small cell lung carcinoma2ClinicalTrials
Colorectal NeoplasmsD015179EFO:1001951colorectal carcinoma4ClinicalTrials
Diabetic RetinopathyD003930EFO:0003770diabetic retinopathy4ClinicalTrials
DailyMed
HistoplasmosisD006660EFO:0007310histoplasmosis1ClinicalTrials
MelanomaD008545EFO:0000756melanoma3ClinicalTrials
Pseudoxanthoma ElasticumD011561Orphanet:758Pseudoxanthoma elasticum2ClinicalTrials
Breast NeoplasmsD001943EFO:0000305breast carcinoma2ClinicalTrials
Colorectal NeoplasmsD015179EFO:0004142colorectal neoplasm4ClinicalTrials
GliosarcomaD018316EFO:1001465gliosarcoma2ClinicalTrials
HemorrhageD006470MP:0001914hemorrhage2ClinicalTrials
LeukemiaD007938EFO:0000565leukemia2ClinicalTrials
Lung NeoplasmsD008175EFO:0001071lung carcinoma2ClinicalTrials
MelanomaD008545EFO:0002617metastatic melanoma3ClinicalTrials
Pancreatic NeoplasmsD010190EFO:0003860pancreatic neoplasm3ClinicalTrials
Wet Macular DegenerationD057135EFO:0004683wet macular degeneration4ClinicalTrials
DailyMed
AstrocytomaD001254EFO:0002499anaplastic astrocytoma2ClinicalTrials
Carcinoid TumorD002276EFO:0004243carcinoid tumor2ClinicalTrials
Carcinoma, Renal CellD002292EFO:0000681renal cell carcinoma2ClinicalTrials
Corneal NeovascularizationD016510EFO:1000880corneal neovascularization1ClinicalTrials
Lymphoma, Non-HodgkinD008228EFO:0005952non-Hodgkins lymphoma1ClinicalTrials
Macular DegenerationD008268EFO:0001365age-related macular degeneration3ClinicalTrials
NeoplasmsD009369EFO:0000616neoplasm4ATC
ClinicalTrials
Retinal DiseasesD012164EFO:0003839retinopathy2ClinicalTrials
Myopia, DegenerativeD047728EFO:0004207pathological myopia3ClinicalTrials
OligodendrogliomaD009837EFO:0000630oligoastrocytoma2ClinicalTrials
Ovarian NeoplasmsD010051EFO:0001075ovarian carcinoma2ClinicalTrials
Prostatic NeoplasmsD011471EFO:0000673prostate adenocarcinoma3ClinicalTrials
Retinal NeovascularizationD015861EFO:0005753ocular vascular disease4ATC
Rectal NeoplasmsD012004EFO:1000657rectum cancer2ClinicalTrials
Urethral NeoplasmsD014523EFO:0003846urethral neoplasm2ClinicalTrials
Colorectal NeoplasmsD015179EFO:0000365colorectal adenocarcinoma4ClinicalTrials
DailyMed
Endometrial NeoplasmsD016889EFO:1001512endometrial carcinoma2ClinicalTrials
GlaucomaD005901EFO:0000516glaucoma3ClinicalTrials
Macular EdemaD0082694ClinicalTrials
DailyMed
MelanomaD008545EFO:0000389cutaneous melanoma3ClinicalTrials
Ovarian NeoplasmsD010051EFO:0003893ovarian neoplasm2ClinicalTrials
Retinal Vein OcclusionD012170EFO:1001157retinal vein occlusion3ClinicalTrials
Retinitis PigmentosaD012174Orphanet:791Retinitis pigmentosa2ClinicalTrials
Thyroid NeoplasmsD013964EFO:0000641papillary thyroid carcinoma2ClinicalTrials
Ureteral NeoplasmsD014516EFO:0003844ureteral neoplasm2ClinicalTrials

Clinical Data

ClinicalTrials.gov AFLIBERCEPT
The Cochrane Collaboration AFLIBERCEPT

Biological Sequence

Description Sequence
Aflibercept fusion protein SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDS RKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKL VLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQ GLYTCAASSGLMTKKNSTFVRVHEKDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPS DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNH YTQKSLSLSPG

Compound Cross References

ATC L - ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS
L01 - ANTINEOPLASTIC AGENTS
L01X - OTHER ANTINEOPLASTIC AGENTS
L01XX - Other antineoplastic agents
L01XX44 - aflibercept

S - SENSORY ORGANS
S01 - OPHTHALMOLOGICALS
S01L - OCULAR VASCULAR DISORDER AGENTS
S01LA - Antineovascularisation agents
S01LA05 - aflibercept

ChemSpider ChemSpider Identifier not yet assigned
DailyMed aflibercept ziv-aflibercept
spacer
spacer