ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1237026
CHEMBL1237026
Compound Name TESAMORELIN
ChEMBL Synonyms TH9507 | TESAMORELIN ACETATE | EGRIFTA | TESAMORELIN
Max Phase 4 (Approved)
Trade Names EGRIFTA

Sources

  • Orange Book
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1237026 compound icon
Drug Type:Oligopeptide Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:N Availability Type:Prescription-only

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
Pulmonary Disease, Chronic ObstructiveD029424EFO:0000341chronic obstructive pulmonary disease2ClinicalTrials
Cognitive DysfunctionD060825HP:0100543cognitive impairment2ClinicalTrials
HIV InfectionsD015658EFO:0000764HIV infection1ClinicalTrials
Diabetes Mellitus, Type 2D003924EFO:0001360type II diabetes mellitus2ClinicalTrials
HIV-Associated Lipodystrophy SyndromeD039682EFO:1001348HIV-Associated Lipodystrophy Syndrome4ClinicalTrials
DailyMed

Clinical Data

ClinicalTrials.gov TESAMORELIN
The Cochrane Collaboration TESAMORELIN

Biological Sequence

Description Sequence
(3E)-hex-3-enoylsomatoliberin YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Compound Cross References

ATC H - SYSTEMIC HORMONAL PREPARATIONS, EXCL. SEX HORMONES AND INSULINS
H01 - PITUITARY AND HYPOTHALAMIC HORMONES AND ANALOGUES
H01A - ANTERIOR PITUITARY LOBE HORMONES AND ANALOGUES
H01AC - Somatropin and somatropin agonists
H01AC06 - tesamorelin

ChemSpider ChemSpider Identifier not yet assigned
spacer
spacer