ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1237025
CHEMBL1237025
Compound Name PEGLOTICASE
ChEMBL Synonyms Krystexxa | PURICASE | PEGLOTICASE
Max Phase 4 (Approved)
Trade Names PURICASE | Krystexxa

Sources

  • Manually Added Drugs
  • Scientific Literature
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1237025 compound icon
Drug Type:Enzyme Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:Y Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Uric acid oxidative enzyme Uric acid DailyMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
GoutD006073EFO:0004274gout4ClinicalTrials
DailyMed
DailyMed
Renal Insufficiency, ChronicD051436EFO:0003884chronic kidney disease1ClinicalTrials

Clinical Data

ClinicalTrials.gov PEGLOTICASE
The Cochrane Collaboration PEGLOTICASE

Biological Sequence

Description Sequence
Pegloticase TYKKNDEVEFVRTGYGKDMIKVLHIQRDGKYHSIKEVATTVQLTLSSKKDYLHGDNSDVI PTDTIKNTVNVLAKFKGIKSIETFAVTICEHFLSSFKHVIRAQVYVEEVPWKRFEKNGVK HVHAFIYTPTGTHFCEVEQIRNGPPVIHSGIKDLKVLKTTQSGFEGFIKDQFTTLPEVKD RCFATQVYCKWRYHQGRDVDFEATWDTVRSIVLQKFAGPYDKGEYSPSVQKTLYDIQVLT LGQVPEIEDMEISLPNIHYLNIDMSKMGLINKEEVLLPLDNPYGKITGTVKRKLSSRL

Compound Bioactivity Summary

Compound Assay Summary

Compound Target Summary

Compound Cross References

ATC M - MUSCULO-SKELETAL SYSTEM
M04 - ANTIGOUT PREPARATIONS
M04A - ANTIGOUT PREPARATIONS
M04AX - Other antigout preparations
M04AX02 - pegloticase

ChemSpider ChemSpider Identifier not yet assigned
DailyMed pegloticase
Wikipedia Pegloticase
spacer
spacer